Property Summary

NCBI Gene PubMed Count 36
PubMed Score 127.51
PubTator Score 255.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
lung cancer -1.200 1.4e-03
malignant mesothelioma 1.700 1.7e-06
medulloblastoma, large-cell -1.300 8.5e-05
osteosarcoma -1.367 6.4e-06
ovarian cancer -1.300 5.8e-07
psoriasis -1.200 5.2e-04

Gene RIF (23)

AA Sequence

MAQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQ      1 - 70
FLVLWKDISPAALPGEELLCCVCRSETVVPGNRLVSCEKCRHAYHQDCHVPRAPAPGEGEGTSWVCRQCV     71 - 140
FAIATKRGGALKKGPYARAMLGMKLSLPYGLKGLDWDAGHLSNRQQSYCYCGGPGEWNLKMLQCRSCLQW    141 - 210
FHEACTQCLSKPLLYGDRFYEFECCVCRGGPEKVRRLQLRWVDVAHLVLYHLSVCCKKKYFDFDREILPF    211 - 280
TSENWDSLLLGELSDTPKGERSSRLLSALNSHKDRFISGREIKKRKCLFGLHARMPPPVEPPTGDGALTS    281 - 350
FPSGQGPGGGVSRPLGKRRRPEPEPLRRRQKGKVEELGPPSAVRNQPEPQEQRERAHLQRALQASVSPPS    351 - 420
PSPNQSYQGSSGYNFRPTDARCLPSSPIRMFASFHPSASTAGTSGDSGPPDRSPLELHIGFPTDIPKSAP    421 - 490
HSMTASSSSVSSPSPGLPRRSAPPSPLCRSLSPGTGGGVRGGVGYLSRGDPVRVLARRVRPDGSVQYLVE    491 - 560
WGGGGIF                                                                   561 - 567
//

Text Mined References (41)

PMID Year Title