Property Summary

NCBI Gene PubMed Count 33
PubMed Score 146.77
PubTator Score 255.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.700 1.7e-06
psoriasis -1.200 5.2e-04
osteosarcoma -1.367 6.4e-06
medulloblastoma, large-cell -1.300 8.5e-05
lung cancer -1.200 1.4e-03
ovarian cancer -1.300 5.8e-07

Gene RIF (21)

PMID Text
26494712 PCL1 binds to and stabilizes p53 to induce cellular quiescence
25923537 the F61L/S86F mutant of MTF2 Tudor-PHD1 was able to bind to H3K36me3 as strong as the PHF1 Tudor bound to this PTM . We concluded that the hydrophobic patch plays an essential role in binding of these Tudors to methylated chromatin
24530230 present two more ESS with MEAF6/PHF1 detected by transcriptome sequencing (case 1) and RT-PCR (case 2), proving that this fusion is recurrent in ESS
24285434 ZC3H7B-BCOR and MEAF6-PHF1 fusions occurred predominantly in S100 protein-negative and malignant OFMT.
23954330 full-length PHF1 in HEK293 cells co-localizes with histone K27me3, but not with K36me3, and this co-localization depends on the trimethyllysine binding pocket indicating that K27me3 is an in vivo target for the PHF1 Tudor domain
23887158 Underscore the likely importance of PHF1 rearrangements in the pathogenesis of ossifying fibromyxoid tumors of soft parts.
23879974 PHF1b may be a molecular transducer of GABA A receptor function and thus GABA-mediated neurotransmission in the central nervous system.
23228662 The histone H3K36me3 binding by the Tudor domains of PHF1, PHF19 and likely MTF2 provide another recruitment and regulatory mechanism for the PRC2 complex.
23211293 All endometrial stromal sarcomas showing sex cords had PHF1 genetic rearrangement, suggesting that such rearrangements may induce sex cord differentiation.
23150668 Polycomb group protein PHF1 regulates p53-dependent cell growth arrest and apoptosis
23142980 findings suggest that PHF1 can mediate deposition of the repressive H3K27me3 mark and acts as a cofactor in early DNA-damage response
23104054 findings show that the interaction of Phf19 with H3K36me2 and H3K36me3 is essential for PRC2 complex activity and for proper regulation of gene repression in embryonic stem cells
22918161 Morphological features, immunoprofile and fluorescence in situ hybridization rearrangements of JAZF1 and PHF1 genes were correlated with tumor category and outcome in endometrial sarcomas
22796436 The PHF1 gene, previously shown to be the 3'-partner of fusion genes in endometrial stromal tumors, is also recurrently involved in the pathogenesis of ossifying fibromyxoid tumors.
19851445 Observational study of gene-disease association. (HuGE Navigator)
19204726 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of PHD finger protein 1 (PHF1) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication
18722875 predicted 684-amino acid JAZF1/PHF1 chimeric protein retained one zinc finger domain from JAZF1 and the two zinc finger domains from PHF1, and its oncogenic mechanism should be similar to that of the JAZF1/SUZ12 protein
18385154 PHF1 interacts physically with Ku70/Ku80, suggesting that PHF1 promotes nonhomologous end-joining processes.
18285464 PHF1 modulates the activity of Ezh2 in favor of the repressive H3K27me3 mark
18086877 The role of PHF1 in H3K27 methylation and Hox gene silencing is reported.

AA Sequence

MAQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQ      1 - 70
FLVLWKDISPAALPGEELLCCVCRSETVVPGNRLVSCEKCRHAYHQDCHVPRAPAPGEGEGTSWVCRQCV     71 - 140
FAIATKRGGALKKGPYARAMLGMKLSLPYGLKGLDWDAGHLSNRQQSYCYCGGPGEWNLKMLQCRSCLQW    141 - 210
FHEACTQCLSKPLLYGDRFYEFECCVCRGGPEKVRRLQLRWVDVAHLVLYHLSVCCKKKYFDFDREILPF    211 - 280
TSENWDSLLLGELSDTPKGERSSRLLSALNSHKDRFISGREIKKRKCLFGLHARMPPPVEPPTGDGALTS    281 - 350
FPSGQGPGGGVSRPLGKRRRPEPEPLRRRQKGKVEELGPPSAVRNQPEPQEQRERAHLQRALQASVSPPS    351 - 420
PSPNQSYQGSSGYNFRPTDARCLPSSPIRMFASFHPSASTAGTSGDSGPPDRSPLELHIGFPTDIPKSAP    421 - 490
HSMTASSSSVSSPSPGLPRRSAPPSPLCRSLSPGTGGGVRGGVGYLSRGDPVRVLARRVRPDGSVQYLVE    491 - 560
WGGGGIF                                                                   561 - 567
//

Text Mined References (39)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26494712 2015 A chromatin-independent role of Polycomb-like 1 to stabilize p53 and promote cellular quiescence.
25923537 2015 An aromatic cage is required but not sufficient for binding of Tudor domains of the Polycomblike protein family to H3K36me3.
25416956 2014 A proteome-scale map of the human interactome network.
24530230 2014 MEAF6/PHF1 is a recurrent gene fusion in endometrial stromal sarcoma.
24285434 2014 Novel ZC3H7B-BCOR, MEAF6-PHF1, and EPC1-PHF1 fusions in ossifying fibromyxoid tumors--molecular characterization shows genetic overlap with endometrial stromal sarcoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23954330 2014 The Tudor domain of the PHD finger protein 1 is a dual reader of lysine trimethylation at lysine 36 of histone H3 and lysine 27 of histone variant H3t.
23887158 2013 PHF1 rearrangements in ossifying fibromyxoid tumors of soft parts: A fluorescence in situ hybridization study of 41 cases with emphasis on the malignant variant.
23879974 2013 Polycomblike protein PHF1b: a transcriptional sensor for GABA receptor activity.
23273982 2013 An H3K36 methylation-engaging Tudor motif of polycomb-like proteins mediates PRC2 complex targeting.
23228662 2013 Tudor domains of the PRC2 components PHF1 and PHF19 selectively bind to histone H3K36me3.
23211293 2013 Endometrial stromal sarcomas with sex cord differentiation are associated with PHF1 rearrangement.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23150668 2013 Polycomb group protein PHF1 regulates p53-dependent cell growth arrest and apoptosis.
23142980 2012 Molecular basis for H3K36me3 recognition by the Tudor domain of PHF1.
23104054 2012 Phf19 links methylated Lys36 of histone H3 to regulation of Polycomb activity.
22918161 2013 Endometrial sarcomas: an immunohistochemical and JAZF1 re-arrangement study in low-grade and undifferentiated tumors.
22796436 2012 Recurrent rearrangement of the PHF1 gene in ossifying fibromyxoid tumors.
22761769 2012 Novel fusion of MYST/Esa1-associated factor 6 and PHF1 in endometrial stromal sarcoma.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20873783 2010 Characterization of hNek6 interactome reveals an important role for its short N-terminal domain and colocalization with proteins at the centrosome.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
18722875 2008 An endometrial stromal sarcoma cell line with the JAZF1/PHF1 chimera.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18385154 2008 A polycomb group protein, PHF1, is involved in the response to DNA double-strand breaks in human cell.
18285464 2008 Ezh2 requires PHF1 to efficiently catalyze H3 lysine 27 trimethylation in vivo.
18086877 2008 Role of hPHF1 in H3K27 methylation and Hox gene silencing.
16397222 2006 Consistent rearrangement of chromosomal band 6p21 with generation of fusion genes JAZF1/PHF1 and EPC1/PHF1 in endometrial stromal sarcoma.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11571280 2001 Polycomblike PHD fingers mediate conserved interaction with enhancer of zeste protein.
9545646 1998 The identification and localization of a human gene with sequence similarity to Polycomblike of Drosophila melanogaster.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.