Property Summary

NCBI Gene PubMed Count 18
PubMed Score 475.40
PubTator Score 15.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.100 1.0e-03
osteosarcoma -1.969 8.5e-07
cystic fibrosis 1.005 5.1e-04
medulloblastoma, large-cell -1.700 5.9e-04
tuberculosis and treatment for 6 months 1.400 3.6e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.5e-02
Breast cancer 2.500 2.8e-02
ovarian cancer -1.500 5.1e-06

Protein-protein Interaction (7)

Gene RIF (5)

PMID Text
26343356 Data show that polycomb-group proteins BMI1, PHC3, CBX6 and CBX7 expression was significantly increased during imatinib treatment.
23942079 PHC3 amplification may emerge as a biomarker in cancer.
22724443 SAM linker controls PHC3 SAM polymerization
20491773 PHC3 is a tumor suppressor in osteosarcoma cells abd its suppression may be caused by modification of polycomb repressive complex 1 in cancer cells.
17001316 loss of PHC3 may favor tumorigenesis by potentially disrupting the ability of cells to remain in G(0)

AA Sequence

MDTEPNPGTSSVSTTTSSTTTTTITTSSSRMQQPQISVYSGSDRHAVQVIQQALHRPPSSAAQYLQQMYA      1 - 70
AQQQHLMLHTAALQQQHLSSSQLQSLAAVQASLSSGRPSTSPTGSVTQQSSMSQTSINLSTSPTPAQLIS     71 - 140
RSQASSSTSGSITQQTMLLGSTSPTLTASQAQMYLRAQMLIFTPATTVAAVQSDIPVVSSSSSSSCQSAA    141 - 210
TQVQNLTLRSQKLGVLSSSQNGPPKSTSQTQSLTICHNKTTVTSSKISQRDPSPESNKKGESPSLESRST    211 - 280
AVTRTSSIHQLIAPASYSPIQPHSLIKHQQIPLHSPPSKVSHHQLILQQQQQQIQPITLQNSTQDPPPSQ    281 - 350
HCIPLQNHGLPPAPSNAQSQHCSPIQSHPSPLTVSPNQSQSAQQSVVVSPPPPHSPSQSPTIIIHPQALI    351 - 420
QPHPLVSSALQPGPNLQQSTANQVQATAQLNLPSHLPLPASPVVHIGPVQQSALVSPGQQIVSPSHQQYS    421 - 490
SLQSSPIPIASPPQMSTSPPAQIPPLPLQSMQSLQVQPEILSQGQVLVQNALVSEEELPAAEALVQLPFQ    491 - 560
TLPPPQTVAVNLQVQPPAPVDPPVVYQVEDVCEEEMPEESDECVRMDRTPPPPTLSPAAITVGRGEDLTS    561 - 630
EHPLLEQVELPAVASVSASVIKSPSDPSHVSVPPPPLLLPAATTRSNSTSMHSSIPSIENKPPQAIVKPQ    631 - 700
ILTHVIEGFVIQEGLEPFPVSRSSLLIEQPVKKRPLLDNQVINSVCVQPELQNNTKHADNSSDTEMEDMI    701 - 770
AEETLEEMDSELLKCEFCGKMGYANEFLRSKRFCTMSCAKRYNVSCSKKFALSRWNRKPDNQSLGHRGRR    771 - 840
PSGPDGAAREHILRQLPITYPSAEEDLASHEDSVPSAMTTRLRRQSERERERELRDVRIRKMPENSDLLP    841 - 910
VAQTEPSIWTVDDVWAFIHSLPGCQDIADEFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKICARINSL    911 - 980
KES                                                                       981 - 983
//

Text Mined References (27)

PMID Year Title
26343356 2015 Polycomb genes are associated with response to imatinib in chronic myeloid leukemia.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23942079 2013 Mutational analysis of Polycomb genes in solid tumours identifies PHC3 amplification as a possible cancer-driving genetic alteration.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22724443 2012 Human polyhomeotic homolog 3 (PHC3) sterile alpha motif (SAM) linker allows open-ended polymerization of PHC3 SAM.
21282530 2011 Interaction proteomics analysis of polycomb proteins defines distinct PRC1 complexes in mammalian cells.
20491773 2010 Polycomb group molecule PHC3 regulates polycomb complex composition and prognosis of osteosarcoma.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19636380 2009 Several distinct polycomb complexes regulate and co-localize on the INK4a tumor suppressor locus.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17001316 2007 PHC3, a component of the hPRC-H complex, associates with E2F6 during G0 and is lost in osteosarcoma tumors.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12384788 2002 Identification and characterisation of novel mammalian homologues of Drosophila polyhomeoticpermits new insights into relationships between members of the polyhomeotic family.
12167701 2002 The core of the polycomb repressive complex is compositionally and functionally conserved in flies and humans.