Property Summary

NCBI Gene PubMed Count 55
PubMed Score 911.73
PubTator Score 450.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... -1.100 1.6e-03
lung cancer 2.000 8.1e-04
medulloblastoma, large-cell 1.300 5.2e-06
Multiple myeloma 1.353 3.9e-03
ovarian cancer 2.000 8.9e-05
sonic hedgehog group medulloblastoma 1.300 3.2e-09

Protein-protein Interaction (2)

Gene RIF (37)

AA Sequence

MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHF      1 - 70
RIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEV     71 - 140
LKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRA    141 - 210
QFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVL    211 - 280
NLQDESFTRGSDSLIKGKK                                                       281 - 299
//

Text Mined References (64)

PMID Year Title