Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.19
PubTator Score 4.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 1.6e-08
cystic fibrosis -1.100 5.8e-04
group 3 medulloblastoma 1.700 3.7e-05
juvenile dermatomyositis 1.302 4.8e-10
osteosarcoma 1.476 2.9e-04
ovarian cancer -1.200 1.5e-05
primitive neuroectodermal tumor 1.100 1.1e-04
psoriasis 1.300 4.2e-04
spina bifida -1.922 2.7e-02

Gene RIF (2)

AA Sequence

MEDPFEEADQPTTEPGMVLDSVEAGDTTPPTKRKSKFSGFGKIFKPWKWRKKKSSDKFKETSEVLERKIS      1 - 70
MRKPREELVKRGVLLEDPEQGGEDPGKPSDAMLKNGHTTPIGNARSSSPVQVEEEPVRLASLRKAIPEED     71 - 140
LKKRLGSTGSQPNSEAESVPENVPKPPLLPPKRPLSSSHEASEGQAKDATSSGGTARFIISTSITTAPAA    141 - 210
TTAATSLAKTVNLSVTPSPAPRTLPAAPASTNTTATPSLTHMVPAKQPPIPPPKPAHRNSNPVIAELSQA    211 - 280
INSGTLLSKPSPPLPPKRGIPSTSVPTLESAAAITTKTPSDEREKSTCSMGSELLPMISPRSPSPPLPTH    281 - 350
IPPEPPRTPPFPAKTFQVVPEIEFPPSLDLHQEIPQQEDQKKEVPKRILDQNFGEPHIPSRLPPLPLHIR    351 - 420
IQQALTSPLPMTPILEGSHRAHSLLFENSDSFSEDSSTLGRTRSLPITIEMLKVPDDEEEEEQTCPSTFS    421 - 490
EEMTPTSVIPKLPQCLREEEEKESDSDSEGPIQYRDEEDEDESYQSALANKVKRKDTLAMKLNHRPSEPE    491 - 560
LNLNSWPCKSKEEWNEIRHQIGNTLIRRLSQRPTPEELEQRNILQPKNEADRQAEKREIKRRLTRKLSQR    561 - 630
PTVAELLARKILRFNEYVEVTDAQDYDRRADKPWTKLTPADKAAIRKELNEFKSSEMEVHEESKHFTRYH    631 - 700
RP                                                                        701 - 702
//

Text Mined References (21)

PMID Year Title