Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.75
PubTator Score 10.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -2.300 1.9e-05
atypical teratoid / rhabdoid tumor -5.100 2.7e-09
ependymoma -2.800 4.6e-02
glioblastoma -2.200 3.8e-04
group 3 medulloblastoma -2.700 2.3e-03
lung adenocarcinoma -1.600 5.4e-05
medulloblastoma, large-cell -4.400 4.5e-09
pancreatic cancer 1.400 4.4e-03
pituitary cancer -3.400 3.5e-06
primitive neuroectodermal tumor -1.800 4.2e-02
psoriasis -1.500 2.9e-47
subependymal giant cell astrocytoma -3.198 3.8e-02

Gene RIF (9)

AA Sequence

MAASEDGSGCLVSRGRSQSDPSVLTDSSATSSADAGENPDEMDQTPPARPEYLVSGIRTPPVRRNSKLAT      1 - 70
LGRIFKPWKWRKKKNEKLKQTTSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPP     71 - 140
TPKSETLTSEDAQPGSPLATGTDQVSLDKPLSSAAHLDDAAKMPSASSGEEADAGSLLPTTNELSQALAG    141 - 210
ADSLDSPPRPLERSVGQLPSPPLLPTPPPKASSKTTKNVTGQATLFQASSMKSADPSLRGQLSTPTGSPH    211 - 280
LTTVHRPLPPSRVIEELHRALATKHRQDSFQGRESKGSPKKRLDVRLSRTSSVERGKEREEAWSFDGALE    281 - 350
NKRTAAKESEENKENLIINSELKDDLLLYQDEEALNDSIISGTLPRKCKKELLAVKLRNRPSKQELEDRN    351 - 420
IFPRRTDEERQEIRQQIEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQRPTVD    421 - 490
ELRDRKILIRFSDYVEVAKAQDYDRRADKPWTRLSAADKAAIRKELNEYKSNEMEVHASSKHLTRFHRP     491 - 559
//

Text Mined References (17)

PMID Year Title