Property Summary

NCBI Gene PubMed Count 17
PubMed Score 0.00
PubTator Score 4.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
acute quadriplegic myopathy 1.147 5.8e-03
adrenocortical carcinoma -1.164 2.6e-02
adult high grade glioma -1.100 1.1e-02
Amyotrophic lateral sclerosis 1.094 6.2e-04
Astrocytoma, Pilocytic -1.100 1.1e-02
atypical teratoid / rhabdoid tumor 2.000 7.5e-04
autosomal dominant Emery-Dreifuss muscul... 1.436 9.7e-03
chronic kidney disease 1.100 3.8e-02
Duchenne muscular dystrophy 1.007 1.2e-03
glioblastoma -2.300 2.6e-09
group 4 medulloblastoma 1.500 2.3e-04
hereditary spastic paraplegia -1.069 4.9e-02
intraductal papillary-mucinous adenoma (... 1.400 4.0e-02
invasive ductal carcinoma -1.100 1.2e-02
juvenile dermatomyositis 1.294 5.8e-08
lung adenocarcinoma -1.300 5.4e-18
lung cancer -1.800 6.0e-03
lung carcinoma -2.800 9.2e-33
malignant mesothelioma -1.300 3.5e-05
non primary Sjogren syndrome sicca -1.100 2.3e-02
non-small cell lung cancer -1.416 7.5e-19
osteosarcoma 1.495 4.6e-03
ovarian cancer -2.100 1.4e-08
permanent atrial fibrillation -1.100 1.7e-02
Pick disease 1.700 1.1e-06
pituitary cancer -2.000 2.5e-07
posterior fossa group B ependymoma -1.200 3.2e-03
primary pancreatic ductal adenocarcinoma 1.066 1.5e-02
Rheumatoid arthritis 1.400 1.9e-02
spina bifida -2.340 3.4e-02

Protein-protein Interaction (5)

Gene RIF (8)

AA Sequence

MDNAVDGLDKASIANSDGPTAGSQTPPFKRKGKLSTIGKIFKPWKWRKKKTSDKFRETSAVLERKISTRQ      1 - 70
SREELIRRGVLKELPDQDGDVTVNFENSNGHMIPIGEESTREENVVKSEEGNGSVSEKTPPLEEQAEDKK     71 - 140
ENTENHSETPAAPALPPSAPPKPRPKPKPKKSPVPPKGATAGASHKGDEVPPIKKNTKAPGKQAPVPPPK    141 - 210
PASRNTTREAAGSSHSKKTTGSKASASPSTSSTSSRPKASKETVSSKAGTVGTTKGKRKTDKQPITSHLS    211 - 280
SDTTTSGTSDLKGEPAETRVESFKLEQTVPGAEEQNTGKFKSMVPPPPVAPAPSPLAPPLPLEDQCITAS    281 - 350
DTPVVLVSVGADLPVSALDPSQLLWAEEPTNRTTLYSGTGLSVNRENAKCFTTKEELGKTVPQLLTPGLM    351 - 420
GESSESFSASEDEGHREYQANDSDSDGPILYTDDEDEDEDEDGSGESALASKIRRRDTLAIKLGNRPSKK    421 - 490
ELEDKNILQRTSEEERQEIRQQIGTKLVRRLSQRPTTEELEQRNILKQKNEEEEQEAKMELKRRLSRKLS    491 - 560
LRPTVAELQARRILRFNEYVEVTDSPDYDRRADKPWARLTPADKAAIRKELNEFKSTEMEVHEESRQFTR    561 - 630
FHRP                                                                      631 - 634
//

Text Mined References (25)

PMID Year Title