Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.20
PubTator Score 12.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7766 2.7e-08
ovarian cancer 8297 1.1e-04
dermatomyositis 941 4.1e-04
group 4 medulloblastoma 1806 6.2e-03
oligodendroglioma 2768 1.7e-02
ependymoma 4559 2.3e-02

Expression

  Differential Expression (6)

Disease log2 FC p
dermatomyositis 1.100 4.1e-04
ependymoma 1.300 2.3e-02
group 4 medulloblastoma 1.100 6.2e-03
oligodendroglioma 1.100 1.7e-02
osteosarcoma 2.037 2.7e-08
ovarian cancer 1.200 1.1e-04

Gene RIF (1)

AA Sequence

MAVAAAAAAGPVFWRRLLGLLPGRPGLAALLGRLSDRLGRNRDRQRRRSPWLLLAPLLSPAVPQVTSPPC      1 - 70
CLCPEGVHRFQWIRNLVPEFGVSSSHVRVLSSPAEFFELMKGQIRVAKRRVVMASLYLGTGPLEQELVDC     71 - 140
LESTLEKSLQAKFPSNLKVSILLDFTRGSRGRKNSRTMLLPLLRRFPEQVRVSLFHTPHLRGLLRLLIPE    141 - 210
RFNETIGLQHIKVYLFDNSVILSGANLSDSYFTNRQDRYVFLQDCAEIADFFTELVDAVGDVSLQLQGDD    211 - 280
TVQVVDGMVHPYKGDRAEYCKAANKRVMDVINSARTRQQMLHAQTFHSNSLLTQEDAAAAGDRRPAPDTW    281 - 350
IYPLIQMKPFEIQIDEIVTETLLTEAERGAKVYLTTGYFNLTQAYMDLVLGTRAEYQILLASPEVNGFFG    351 - 420
AKGVAGAIPAAYVHIERQFFSEVCSLGQQERVQLQEYWRRGWTFHAKGLWLYLAGSSLPCLTLIGSPNFG    421 - 490
YRSVHRDLEAQIAIVTENQALQQQLHQEQEQLYLRSGVVSSATFEQPSRQVKLWVKMVTPLIKNFF        491 - 556
//

Text Mined References (13)

PMID Year Title