Property Summary

NCBI Gene PubMed Count 13
PubMed Score 94.66
PubTator Score 1178.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.100 3.6e-03
ependymoma -1.400 4.7e-03
sonic hedgehog group medulloblastoma -1.400 4.5e-06
tuberculosis 1.200 3.3e-08
pilocytic astrocytoma -1.100 1.5e-07
subependymal giant cell astrocytoma -1.032 3.2e-02
Breast cancer 1.500 9.6e-18
invasive ductal carcinoma 1.100 6.9e-03
pancreatic cancer 1.100 7.8e-03

Synonym

Accession A6NDG6 G3PP
Symbols AUM
G3PP
PGPase

Gene

PGP

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

PMID Text
25720491 Data indicate that Di-2-pyridylketone 4,4-dimethyl-3-thiosemicarbazone (Dp44mT) overcomes multidrug resistance (MDR) via utilization of lysosomal P-glycoprotein (Pgp) transport activity.
21861206 acute myeloid leukemia patients with co-expression of PGP and Ly showed better overall survival compared with PGP(+) patients without Ly expression
20091410 expressed in skin lesions from groins and axilla in patients with hidradenitis suppurativa
18640717 the PI3K/Akt pathway is involved in MDR in lymphoma cell lines and PI3K/Akt inhibition correlates down-regulation of NF-kappaB activity and inhibition Pgp function.
17038883 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16160620 Observational study of gene-disease association. (HuGE Navigator)
15661399 cerp-gp confers resistance to ceramide-induced apoptosis, with modulation of the ceramide-glucosylceramide pathway GCS making a marked contribution to this resistance
15260917 "The available data indicate that St. John's wort is a potent induced of CYP 3A4 and P-glycoprotein (PgP), although it may inhibit or induce other CYPs..." See page 262.

AA Sequence

MAAAEAGGDDARCVRLSAERAQALLADVDTLLFDCDGVLWRGETAVPGAPEALRALRARGKRLGFITNNS      1 - 70
SKTRAAYAEKLRRLGFGGPAGPGASLEVFGTAYCTALYLRQRLAGAPAPKAYVLGSPALAAELEAVGVAS     71 - 140
VGVGPEPLQGEGPGDWLHAPLEPDVRAVVVGFDPHFSYMKLTKALRYLQQPGCLLVGTNMDNRLPLENGR    141 - 210
FIAGTGCLVRAVEMAAQRQADIIGKPSRFIFDCVSQEYGINPERTVMVGDRLDTDILLGATCGLKTILTL    211 - 280
TGVSTLGDVKNNQESDCVSKKKMVPDFYVDSIADLLPALQG                                 281 - 321
//

Text Mined References (16)

PMID Year Title
26755581 2016 Identification of a mammalian glycerol-3-phosphate phosphatase: Role in metabolism and signaling in pancreatic ?-cells and hepatocytes.
25720491 2015 Di-2-pyridylketone 4,4-dimethyl-3-thiosemicarbazone (Dp44mT) overcomes multidrug resistance by a novel mechanism involving the hijacking of lysosomal P-glycoprotein (Pgp).
21861206 2012 Association between P-glycoprotein and lymphoid antigen expression on myeloblasts versus therapy response and survival in de novo acute myeloid leukemia: long-term follow-up results.
21269460 2011 Initial characterization of the human central proteome.
20091410 2010 Cutaneous PGP 9.5 distribution patterns in hidradenitis suppurativa.
18640717 2009 PI3K/Akt inhibition modulates multidrug resistance and activates NF-kappaB in murine lymphoma cell lines.
17038883 2006 The relationship between P-glycoprotein (PGP) polymorphisms and response to olanzapine treatment in schizophrenia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16160620 2005 Polymorphic variations in GSTM1, GSTT1, PgP, CYP2D6, CYP3A5, and dopamine D2 and D3 receptors and their association with tardive dyskinesia in severe mental illness.
15661399 2005 P-glycoprotein is implicated in the inhibition of ceramide-induced apoptosis in TF-1 acute myeloid leukemia cells by modulation of the glucosylceramide synthase pathway.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15260917 2004 Pharmacokinetic interactions of drugs with St John's wort.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
6273902 1981 Regional assignment of genes for human alpha-globin and phosphoglycollate phosphatase to the short arm of chromosome 16.
2164460 1990 Localisation of human PGP and HAGH genes to 16p13.3.
215071 1978 Genetic polymorphism of human phosphoglycolate phosphatase (PGP).