Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.21
PubTator Score 6.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -1.507 3.1e-02
adult high grade glioma 1.100 1.1e-04
Atopic dermatitis -1.500 1.4e-03
breast carcinoma -1.100 8.3e-05
colon cancer -3.300 2.8e-09
ductal carcinoma in situ -2.300 4.6e-05
ependymoma 1.200 2.5e-03
intraductal papillary-mucinous adenoma (... -1.300 9.7e-05
intraductal papillary-mucinous carcinoma... -1.100 8.2e-03
intraductal papillary-mucinous neoplasm ... -1.500 1.3e-03
invasive ductal carcinoma -2.900 2.0e-04
lung adenocarcinoma -1.400 3.3e-17
lung cancer -1.100 1.6e-03
lung carcinoma -1.100 4.9e-12
medulloblastoma, large-cell 1.100 2.2e-03
non primary Sjogren syndrome sicca -1.300 2.8e-02
non-small cell lung cancer -2.709 3.5e-29
ovarian cancer -2.700 1.7e-09
psoriasis -1.200 2.2e-26

Gene RIF (1)

AA Sequence

MEGSPIPVLTVPTAPYEDQRPAGGGGLRRPTGLFEGQRNYLPNFIQSVLSSIDLRDRQGCTMVVGSDGRY      1 - 70
FSRTAIEIVVQMAAANGIGRLIIGQNGILSTPAVSCIIRKIKAAGGIILTASHCPGGPGGEFGVKFNVAN     71 - 140
GGPAPDVVSDKIYQISKTIEEYAICPDLRIDLSRLGRQEFDLENKFKPFRVEIVDPVDIYLNLLRTIFDF    141 - 210
HAIKGLLTGPSQLKIRIDAMHGVMGPYVRKVLCDELGAPANSAINCVPLEDFGGQHPDPNLTYATTLLEA    211 - 280
MKGGEYGFGAAFDADGDRYMILGQNGFFVSPSDSLAIIAANLSCIPYFRQMGVRGFGRSMPTSMALDRVA    281 - 350
KSMKVPVYETPAGWRFFSNLMDSGRCNLCGEESFGTGSDHLREKDGLWAVLVWLSIIAARKQSVEEIVRD    351 - 420
HWAKFGRHYYCRFDYEGLDPKTTYYIMRDLEALVTDKSFIGQQFAVGSHVYSVAKTDSFEYVDPVDGTVT    421 - 490
KKQGLRIIFSDASRLIFRLSSSSGVRATLRLYAESYERDPSGHDQEPQAVLSPLIAIALKISQIHERTGR    491 - 560
RGPTVIT                                                                   561 - 567
//

Text Mined References (14)

PMID Year Title