Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.73
PubTator Score 1.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
active ulcerative colitis 1.128 3.2e-02
adrenocortical carcinoma 1.252 4.3e-02
adult high grade glioma -2.100 2.9e-03
astrocytic glioma -3.000 3.5e-03
Astrocytoma, Pilocytic -2.300 8.6e-07
atypical teratoid / rhabdoid tumor -4.600 1.6e-08
ductal carcinoma in situ 1.300 1.1e-03
ependymoma -3.800 2.5e-02
gastric cancer 1.100 8.6e-03
glioblastoma -2.100 2.7e-05
group 3 medulloblastoma -1.400 4.1e-02
intraductal papillary-mucinous adenoma (... 1.800 8.1e-03
intraductal papillary-mucinous neoplasm ... 1.500 3.4e-02
lung adenocarcinoma 1.100 4.0e-09
medulloblastoma, large-cell -3.400 3.6e-05
non-small cell lung cancer 1.641 1.8e-12
oligodendroglioma -2.900 7.2e-03
osteosarcoma 1.438 1.8e-07
ovarian cancer 1.200 1.7e-04
pancreatic cancer 1.200 1.9e-04
pancreatic ductal adenocarcinoma liver m... 2.035 1.2e-02
Pick disease -2.100 1.6e-02
pituitary cancer 1.400 5.3e-04
Rheumatoid arthritis 1.300 1.6e-02
tuberculosis -1.400 2.0e-04
X-linked cerebral adrenoleukodystrophy 1.200 2.3e-02

 GWAS Trait (1)

Gene RIF (2)

AA Sequence

MAENTEGDLNSNLLHAPYHTGDPQLDTAIGQWLRWDKNPKTKEQIENLLRNGMNKELRDRLCCRMTFGTA      1 - 70
GLRSAMGAGFCYINDLTVIQSTQGMYKYLERCFSDFKQRGFVVGYDTRGQVTSSCSSQRLAKLTAAVLLA     71 - 140
KDVPVYLFSRYVPTPFVPYAVQKLKAVAGVMITASHNRKEDNGYKVYWETGAQITSPHDKEILKCIEECV    141 - 210
EPWNGSWNDNLVDTSPLKRDPLQDICRRYMEDLKKICFYRELNSKTTLKFVHTSFHGVGHDYVQLAFKVF    211 - 280
GFKPPIPVPEQKDPDPDFSTVKCPNPEEGESVLELSLRLAEKENARVVLATDPDADRLAAAELQENGCWK    281 - 350
VFTGNELAALFGWWMFDCWKKNKSRNADVKNVYMLATTVSSKILKAIALKEGFHFEETLPGFKWIGSRII    351 - 420
DLLENGKEVLFAFEESIGFLCGTSVLDKDGVSAAVVVAEMASYLETMNITLKQQLVKVYEKYGYHISKTS    421 - 490
YFLCYEPPTIKSIFERLRNFDSPKEYPKFCGTFAILHVRDVTTGYDSSQPNKKSVLPVSKNSQMITFTFQ    491 - 560
NGCVATLRTSGTEPKIKYYAEMCASPDQSDTALLEEELKKLIDALIENFLQPSKNGLIWRSV            561 - 622
//

Text Mined References (17)

PMID Year Title