Property Summary

NCBI Gene PubMed Count 21
PubMed Score 74.64
PubTator Score 57.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
glioblastoma 1.700 1.4e-08
osteosarcoma -1.168 3.8e-02
posterior fossa group A ependymoma 1.400 1.4e-08
intraductal papillary-mucinous neoplasm ... 1.100 4.0e-02
pediatric high grade glioma 1.400 1.9e-05
pilocytic astrocytoma 1.800 1.5e-07
sonic hedgehog group medulloblastoma 1.200 1.4e-03
psoriasis 1.800 5.0e-45
gastric carcinoma 1.500 1.4e-02
ductal carcinoma in situ 1.200 3.4e-04
ovarian cancer -1.200 1.4e-06
Breast cancer 1.200 4.5e-05
pituitary cancer -1.200 1.5e-03

 MGI Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (1)

PMID Text
17804405 In the present work, phosphopentomutase was purified from human erythrocytes and found it to copurify with a 68-kDa polypeptide that was identified by mass spectrometry as PGM2, sharing about 20% identity with mammalian phosphoglucomutase 1.

AA Sequence

MAAPEGSGLGEDARLDQETAQWLRWDKNSLTLEAVKRLIAEGNKEELRKCFGARMEFGTAGLRAAMGPGI      1 - 70
SRMNDLTIIQTTQGFCRYLEKQFSDLKQKGIVISFDARAHPSSGGSSRRFARLAATTFISQGIPVYLFSD     71 - 140
ITPTPFVPFTVSHLKLCAGIMITASHNPKQDNGYKVYWDNGAQIISPHDKGISQAIEENLEPWPQAWDDS    141 - 210
LIDSSPLLHNPSASINNDYFEDLKKYCFHRSVNRETKVKFVHTSVHGVGHSFVQSAFKAFDLVPPEAVPE    211 - 280
QKDPDPEFPTVKYPNPEEGKGVLTLSFALADKTKARIVLANDPDADRLAVAEKQDSGEWRVFSGNELGAL    281 - 350
LGWWLFTSWKEKNQDRSALKDTYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAKQLIDQGKTVL    351 - 420
FAFEEAIGYMCCPFVLDKDGVSAAVISAELASFLATKNLSLSQQLKAIYVEYGYHITKASYFICHDQETI    421 - 490
KKLFENLRNYDGKNNYPKACGKFEISAIRDLTTGYDDSQPDKKAVLPTSKSSQMITFTFANGGVATMRTS    491 - 560
GTEPKIKYYAELCAPPGNSDPEQLKKELNELVSAIEEHFFQPQKYNLQPKAD                      561 - 612
//

Text Mined References (30)

PMID Year Title
25277244 2014 The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17804405 2007 Molecular identification of mammalian phosphopentomutase and glucose-1,6-bisphosphate synthase, two members of the alpha-D-phosphohexomutase family.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
9549096 1998 A phylogenetic approach to the identification of phosphoglucomutase genes.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7902568 1993 The classical human phosphoglucomutase (PGM1) isozyme polymorphism is generated by intragenic recombination.
5885461 1965 Evidence for a second "structural" locus determining human phosphoglucomutase.
1840235 1991 Antigenic analysis of the major human phosphoglucomutase isozymes: PGM1, PGM2, PGM3 and PGM4.
1203483 1975 Further data on the assignment of the phosphoglucomutase (PGM2) gene locus to chromosome 4 in man.
1192820 1975 Further data on the assignment of the phosphoglucomutase2 (PGM2) gene locus to chromosome 4 in man.
885546 1977 The human PGM-2 and its chromosomal localization in man-mouse hybrids.
752512 1978 Human PGM2 (E.C. 2.7.5.1) mapped to 4pter leads to 4q25.
752511 1978 Regional assignment of genes for phosphoglucomutase2 and peptidase S to 4pter leads to 4q21 in man.
564278 1978 Regional localization of human phosphoglucomutase-2 locus on chromosome 4.