Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.75
PubTator Score 5.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 5.9e-14
ovarian cancer 8520 4.3e-12
medulloblastoma, large-cell 6241 2.6e-05
osteosarcoma 7950 8.5e-04
diabetes mellitus 1728 1.9e-03
adult high grade glioma 3801 4.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma 1.100 4.2e-03
diabetes mellitus 1.100 1.9e-03
medulloblastoma, large-cell 1.500 2.6e-05
osteosarcoma 1.036 8.5e-04
ovarian cancer 1.600 4.3e-12
psoriasis 1.400 5.9e-14

Gene RIF (7)

AA Sequence

MLPWLLVFSALGIQAWGDSSWNKTQAKQVSEGLQYLFENISQLTEKGLPTDVSTTVSRKAWGAEAVGCSI      1 - 70
QLTTPVNVLVIHHVPGLECHDQTVCSQRLRELQAHHVHNNSGCDVAYNFLVGDDGRVYEGVGWNIQGVHT     71 - 140
QGYNNISLGFAFFGTKKGHSPSPAALSAMENLITYAVQKGHLSSSYVQPLLGKGENCLAPRQKTSLKKAC    141 - 210
PGVVPRSVWGARETHCPRMTLPAKYGIIIHTAGRTCNISDECRLLVRDIQSFYIDRLKSCDIGYNFLVGQ    211 - 280
DGAIYEGVGWNVQGSSTPGYDDIALGITFMGTFTGIPPNAAALEAAQDLIQCAMVKGYLTPNYLLVGHSD    281 - 350
VARTLSPGQALYNIISTWPHFKH                                                   351 - 373
//

Text Mined References (12)

PMID Year Title