Property Summary

NCBI Gene PubMed Count 20
PubMed Score 37.85
PubTator Score 9.59

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.100 1.1e-06
psoriasis 1.100 2.7e-36

Gene RIF (7)

PMID Text
26039076 a significant induction of three PGLYRPs 2-4 in primary human corneal epithelial cells (HCECs) exposed to live or heat-killed Candida albicans, is reported.
22099350 anti-inflammatory role in intestinal epithelial cells during antibacterial immune response
21451128 expression of PGlyRP3 can be regulated by dietary factors such as probiotic oligosaccharides; PPARgamma is involved in regulation of expression of PGlyRP3 in intestinal mucosa by dietary components
20237496 Observational study of gene-disease association. (HuGE Navigator)
19601998 Observational study of gene-disease association. (HuGE Navigator)
16362825 Data are consistent with previous reports of association of psoriasis with genes on 1q21, and suggest a role for Pglyrp3 in skin biology.
16354652 Results describe the function of mammalian antimicrobial peptidoglycan recognition proteins 3 and 4, and show that they are a new class of bactericidal and bacteriostatic proteins.

AA Sequence

MGTLPWLLAFFILGLQAWDTPTIVSRKEWGARPLACRALLTLPVAYIITDQLPGMQCQQQSVCSQMLRGL      1 - 70
QSHSVYTIGWCDVAYNFLVGDDGRVYEGVGWNIQGLHTQGYNNISLGIAFFGNKIGSSPSPAALSAAEGL     71 - 140
ISYAIQKGHLSPRYIQPLLLKEETCLDPQHPVMPRKVCPNIIKRSAWEARETHCPKMNLPAKYVIIIHTA    141 - 210
GTSCTVSTDCQTVVRNIQSFHMDTRNFCDIGYHFLVGQDGGVYEGVGWHIQGSHTYGFNDIALGIAFIGY    211 - 280
FVEKPPNAAALEAAQDLIQCAVVEGYLTPNYLLMGHSDVVNILSPGQALYNIISTWPHFKH             281 - 341
//

Text Mined References (21)

PMID Year Title
26039076 2015 A Novel Innate Response of Human Corneal Epithelium to Heat-killed Candida albicans by Producing Peptidoglycan Recognition Proteins.
22099350 2012 Peptidoglycan recognition protein 3 (PglyRP3) has an anti-inflammatory role in intestinal epithelial cells.
21602801 2011 Peptidoglycan recognition proteins kill bacteria by activating protein-sensing two-component systems.
21451128 2011 Prebiotic oligosaccharides reduce proinflammatory cytokines in intestinal Caco-2 cells via activation of PPAR? and peptidoglycan recognition protein 3.
21176858 2011 PPAR?-dependent peptidoglycan recognition protein 3 (PGlyRP3) expression regulates proinflammatory cytokines by microbial and dietary fatty acids.
20418257 2010 Review: Mammalian peptidoglycan recognition proteins (PGRPs) in innate immunity.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19601998 2009 Variation in genes of the epidermal differentiation complex in German atopic dermatitis patients.
17502600 2007 Structural insights into the bactericidal mechanism of human peptidoglycan recognition proteins.
17363965 2007 Peptidoglycan recognition proteins: pleiotropic sensors and effectors of antimicrobial defences.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16641493 2006 Crystal structure of human peptidoglycan recognition protein I alpha bound to a muramyl pentapeptide from Gram-positive bacteria.
16362825 2006 Peptidoglycan recognition proteins Pglyrp3 and Pglyrp4 are encoded from the epidermal differentiation complex and are candidate genes for the Psors4 locus on chromosome 1q21.
16354652 2006 Peptidoglycan recognition proteins are a new class of human bactericidal proteins.
15826377 2005 Crystal structure of a peptidoglycan recognition protein (PGRP) in complex with a muramyl tripeptide from Gram-positive bacteria.
15572450 2004 Structural basis for peptidoglycan binding by peptidoglycan recognition proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15140887 2004 Crystal structure of the C-terminal peptidoglycan-binding domain of human peptidoglycan recognition protein Ialpha.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11461926 2001 Peptidoglycan recognition proteins: a novel family of four human innate immunity pattern recognition molecules.