Property Summary

NCBI Gene PubMed Count 30
PubMed Score 230.89
PubTator Score 69.77

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -3.493 1.1e-05
mucosa-associated lymphoid tissue lympho... 2.247 2.6e-02

Gene RIF (20)

PMID Text
26654597 Tag7-Mts1 complex causes chemotactic migration of lymphocytes, with NK cells being a preferred target.
26183779 Tag7, can bind to the TNFR1 receptor, thereby inhibiting the cytotoxic actions of the Tag7-Hsp70 complex and TNF-alpha, an acquired immunity cytokine.
25595774 The role for PGLYRP1 as a TREM-1 activator provides a new mechanism by which bacteria can trigger myeloid cells, linking two known, but previously unrelated, pathways in innate immunity.
25221852 The association study in a discovery sample of 200 French trio families revealed a significant association with rheumatoid arthritis for one SNP, PGLYRP1-rs2041992 (p = 0.019).
22037021 shown that HspBP1 binds Tag7 in the conditioned medium of tumor CSML0 cells, thereby preventing formation of the cytotoxic Tag7-Hsp70 complex
21984701 The PGRP-S promoter provides a useful reporter of M cell mucosal epithelium lineage commitment, corresponding to the expression of PGRP in M cells.
21247889 HspBP1 inhibited the cytotoxic activity of the Tag7-Hsp70 complex secreted by lymphocytes. HspBP1
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19666596 S100A4 has opposite roles in Tag7 and Hsp70- mediated tumoricidal mechanisms
19023966 Data show that removal of both Tag7 and S100A4 from neutrophil conditioned medium reduced lysis of E. coli, while addition of the Tag7-S100A4 complex to the medium restored antibacterial activity.
18774573 peptidoglycan recognition protein-1 has a role in coronary and peripheral atherosclerosis
18643845 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.
15956276 human PGRP-S plays a role in innate immunity in the context of neutrophils by contributing to the killing of intracellular and extracellular bacteria
15769462 crystal structure of peptidoglycan recognition protein S
15572450 determined the crystal structure, at 2.30-A resolution, of the C-terminal PGN-binding domain of human PGRP-Ialpha in complex with a muramyl tripeptide representing the core of lysine-type PGNs from Gram-positive bacteria
15140887 crystal structure of the C-terminal PGN-binding domain of PGRP-Ialpha in two oligomeric states, monomer and dimer
14585845 Peptidoglycan recognition protein tag7 forms a cytotoxic complex with heat shock protein 70 in solution and in lymphocytes.
14506276 identification as an N-acetylmuramoyl-l-alanine amidase and this function is conserved in prokaryotes, insects, and mammals
12669421 Various types of human blood cells were tested for expression of the Tag7/PGRP-SA and TagL/PGRP-L proteins, which belong to the family of proteins possessing the lysozyme-like peptidoglycan recognition protein (PGRP) domain

AA Sequence

MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTP      1 - 70
ASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVP     71 - 140
TPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP                  141 - 196
//

Text Mined References (31)

PMID Year Title
26654597 2015 A new role for PGRP-S (Tag7) in immune defense: lymphocyte migration is induced by a chemoattractant complex of Tag7 with Mts1.
26183779 2015 Tag7 (PGLYRP1) in Complex with Hsp70 Induces Alternative Cytotoxic Processes in Tumor Cells via TNFR1 Receptor.
25595774 2015 Cutting Edge: identification of neutrophil PGLYRP1 as a ligand for TREM-1.
25221852 2015 Relationship between SNPs and expression level for candidate genes in rheumatoid arthritis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22037021 2012 Extracellular HspBP1 inhibits formation of a cytotoxic Tag7-Hsp70 complex in vitro and in human serum.
21984701 2011 Convergent and divergent development among M cell lineages in mouse mucosal epithelium.
21247889 2011 The heat shock-binding protein (HspBP1) protects cells against the cytotoxic action of the Tag7-Hsp70 complex.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19666596 2009 Opposite roles of metastasin (S100A4) in two potentially tumoricidal mechanisms involving human lymphocyte protein Tag7 and Hsp70.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19023966 2008 Interactions and possible functional characteristics of Tag7-S100A4 protein complex.
18774573 2009 The association between peptidoglycan recognition protein-1 and coronary and peripheral atherosclerosis: Observations from the Dallas Heart Study.
18643845 2009 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.
17502600 2007 Structural insights into the bactericidal mechanism of human peptidoglycan recognition proteins.
16354652 2006 Peptidoglycan recognition proteins are a new class of human bactericidal proteins.
15956276 2005 Human peptidoglycan recognition protein S is an effector of neutrophil-mediated innate immunity.
15769462 2005 Crystal structure of human peptidoglycan recognition protein S (PGRP-S) at 1.70 A resolution.
15572450 2004 Structural basis for peptidoglycan binding by peptidoglycan recognition proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15140887 2004 Crystal structure of the C-terminal peptidoglycan-binding domain of human peptidoglycan recognition protein Ialpha.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14585845 2004 Peptidoglycan recognition protein tag7 forms a cytotoxic complex with heat shock protein 70 in solution and in lymphocytes.
14506276 2003 Human peptidoglycan recognition protein-L is an N-acetylmuramoyl-L-alanine amidase.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12669421 2003 [Expression analysis of proteins encoded by genes of the tag7/tagL (PGRP-S,L) family in human peripheral blood cells].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11461926 2001 Peptidoglycan recognition proteins: a novel family of four human innate immunity pattern recognition molecules.
9707603 1998 A peptidoglycan recognition protein in innate immunity conserved from insects to humans.