Property Summary

NCBI Gene PubMed Count 9
PubMed Score 182.33
PubTator Score 13.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.075 8.7e-07
adult high grade glioma 1.200 3.5e-03
astrocytoma 1.700 2.9e-04
atypical teratoid / rhabdoid tumor 1.600 3.6e-08
diabetes mellitus -1.200 1.8e-03
ependymoma 1.200 3.4e-11
glioblastoma 1.700 1.2e-02
group 3 medulloblastoma 1.100 6.7e-03
osteosarcoma 2.473 7.5e-09
ovarian cancer 2.800 3.6e-06
primitive neuroectodermal tumor 1.100 2.0e-04
psoriasis 1.300 1.5e-04
subependymal giant cell astrocytoma 1.343 2.8e-03
tuberculosis 1.200 2.6e-07

AA Sequence

MAAPAPGLISVFSSSQELGAALAQLVAQRAACCLAGARARFALGLSGGSLVSMLARELPAAVAPAGPASL      1 - 70
ARWTLGFCDERLVPFDHAESTYGLYRTHLLSRLPIPESQVITINPELPVEEAAEDYAKKLRQAFQGDSIP     71 - 140
VFDLLILGVGPDGHTCSLFPDHPLLQEREKIVAPISDSPKPPPQRVTLTLPVLNAARTVIFVATGEGKAA    141 - 210
VLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL                          211 - 258
//

Text Mined References (14)

PMID Year Title