Property Summary

NCBI Gene PubMed Count 9
PubMed Score 159.66
PubTator Score 13.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis 1.300 1.5e-04
glioblastoma 1.700 1.2e-02
osteosarcoma 2.473 7.5e-09
ependymoma 1.200 3.4e-11
sonic hedgehog group medulloblastoma 1.400 1.5e-05
astrocytoma 1.700 2.9e-04
atypical teratoid / rhabdoid tumor 1.600 3.6e-08
primitive neuroectodermal tumor 1.100 2.0e-04
acute quadriplegic myopathy 1.075 8.7e-07
tuberculosis 1.200 2.6e-07
diabetes mellitus -1.200 1.8e-03
adult high grade glioma 1.200 3.5e-03
subependymal giant cell astrocytoma 1.343 2.8e-03
ovarian cancer 2.800 3.6e-06

Synonym

Accession O95336 6PGL
Symbols 6PGL
HEL-S-304

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

AA Sequence

MAAPAPGLISVFSSSQELGAALAQLVAQRAACCLAGARARFALGLSGGSLVSMLARELPAAVAPAGPASL      1 - 70
ARWTLGFCDERLVPFDHAESTYGLYRTHLLSRLPIPESQVITINPELPVEEAAEDYAKKLRQAFQGDSIP     71 - 140
VFDLLILGVGPDGHTCSLFPDHPLLQEREKIVAPISDSPKPPPQRVTLTLPVLNAARTVIFVATGEGKAA    141 - 210
VLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL                          211 - 258
//

Text Mined References (14)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11457850 2001 NMR spectroscopic analysis of the first two steps of the pentose-phosphate pathway elucidates the role of 6-phosphogluconolactonase.
10518023 1999 Identification of the cDNA encoding human 6-phosphogluconolactonase, the enzyme catalyzing the second step of the pentose phosphate pathway(1).