Property Summary

NCBI Gene PubMed Count 24
PubMed Score 68.01
PubTator Score 27.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Protein-protein Interaction (1)

Gene RIF (2)

PMID Text
24000349 Data from studies in transgenic mice suggest that Pgk2 core promoter elements are required to direct demethylation of DNA and reconfiguration of nucleosomes in testis during sexual maturation and spermatogenesis.
18976975 Knockdown of phosphoglycerate kinase 2 (PGK2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MSLSKKLTLDKLDVRGKRVIMRVDFNVPMKKNQITNNQRIKASIPSIKYCLDNGAKAVVLMSHLGRPDGV      1 - 70
PMPDKYSLAPVAVELKSLLGKDVLFLKDCVGAEVEKACANPAPGSVILLENLRFHVEEEGKGQDPSGKKI     71 - 140
KAEPDKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPHKASGFLMKKELDYFAKALENPVRPFLA    141 - 210
ILGGAKVADKIQLIKNMLDKVNEMIIGGGMAYTFLKVLNNMEIGASLFDEEGAKIVKDIMAKAQKNGVRI    211 - 280
TFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGPLGVFEWDAFAK    281 - 350
GTKALMDEIVKATSKGCITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM       351 - 417
//

Text Mined References (28)

PMID Year Title
26677959 2016 Characteristics of testis-specific phosphoglycerate kinase 2 and its association with human sperm quality.
24000349 2013 Sequence-specific promoter elements regulate temporal-specific changes in chromatin required for testis-specific activation of the Pgk2 gene.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20459611 2010 Frequent and recent retrotransposition of orthologous genes plays a role in the evolution of sperm glycolytic enzymes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19333399 2009 Spermatogenesis associated retrogenes are expressed in the human ovary and ovarian cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10330089 1999 Multiple elements influence transcriptional regulation from the human testis-specific PGK2 promoter in transgenic mice.
9023984 1996 Analysis of the cDNA and encoded protein of the human testis-specific PGK-2 gene.
6873461 1983 Haploid accumulation and translational control of phosphoglycerate kinase-2 messenger RNA during mouse spermatogenesis.
6328504 1984 A human autosomal phosphoglycerate kinase locus maps near the HLA cluster.
3839763 1985 Molecular cloning and structure of an autosomal processed gene for human phosphoglycerate kinase.
3453121 1987 Human testis-specific PGK gene lacks introns and possesses characteristics of a processed gene.
2987238 1985 The human phosphoglycerate kinase multigene family. HLA-associated sequences and an X-linked locus containing a processed pseudogene and its functional counterpart.
2886978 1987 A human anonymous low copy number clone, 4c11 (D6S4), localized to 6p12-6p21, detects 2 RFLPs, one of which is moderately polymorphic.
2813402 1989 Transcriptional regulatory regions of testis-specific PGK2 defined in transgenic mice.
2767684 1989 Human homologs of two testes-expressed loci on mouse chromosome 17 map to opposite arms of chromosome 6.
2156237 1990 Molecular evolution of the human Pgk-2 retroposon.
2032717 1991 A centromere-based genetic map of the short arm of human chromosome 6.
2027764 1991 Determining transcript number using the polymerase chain reaction: Pgk-2, mP2, and PGK-2 transgene mRNA levels during spermatogenesis.
1278465 1976 Characterization of phosphoglycerate kinase from human spermatozoa.