Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.88
PubTator Score 0.50

Knowledge Summary


No data available


  Differential Expression (9)

Disease log2 FC p
chronic lymphocytic leukemia 1.846 4.9e-05
osteosarcoma -1.819 6.0e-05
pancreatic ductal adenocarcinoma liver m... 2.008 8.6e-03
active ulcerative colitis 1.844 2.1e-02
fibroadenoma 1.400 2.8e-02
subependymal giant cell astrocytoma 1.021 2.3e-02
lung adenocarcinoma 1.100 1.0e-02
ovarian cancer 1.200 1.0e-02
pancreatic cancer -1.700 4.5e-03

Gene RIF (1)

19834535 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

FPGRTFSDVRDPLQSPLWVTLGSSSPTESLTVDPASE                                     701 - 737

Text Mined References (12)

PMID Year Title
26682924 2016 Catalytic site of human protein-glucosylgalactosylhydroxylysine glucosidase: Three crucial carboxyl residues were determined by cloning and site-directed mutagenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12693554 2003 Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.