Property Summary

NCBI Gene PubMed Count 27
PubMed Score 348.59
PubTator Score 128.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.289 6.7e-04
malignant mesothelioma 1.200 3.4e-06
esophageal adenocarcinoma -2.100 4.1e-02
osteosarcoma 1.111 2.9e-06
group 3 medulloblastoma 1.500 4.7e-04
astrocytoma 1.300 4.6e-02
glioblastoma 1.200 9.8e-03
atypical teratoid / rhabdoid tumor 1.200 2.8e-04
medulloblastoma, large-cell 1.800 9.9e-06
primitive neuroectodermal tumor 1.300 2.7e-04
acute quadriplegic myopathy 1.114 5.0e-07
colon cancer 2.400 2.2e-02
diabetes mellitus -1.400 1.4e-02
pediatric high grade glioma 1.100 2.6e-05

 IMPC Phenotype (1)

 MGI Phenotype (1)

Protein-protein Interaction (4)

Gene RIF (11)

PMID Text
26479318 Studies indicate link between the 6-phosphogluconate dehydrogenase, oxidative pentose phosphate pathway (PPP) and lipogenesis through Ru-5-P-dependent inhibition of serine/threonine protein kinase LKB1-AMPK signalling.
25042803 Results show that 6PGD activity is upregulated with increased lysine acetylation in primary leukemia cells from human patients, providing mechanistic insights into 6PGD upregulation in cancer cells.
24125036 copy number gain of the PGD gene was consistently identified in cervical cancers but not in the normal tissues
23973484 Expression of 6PGD positively correlates with advancing stage of lung carcinoma. Knockdown of 6PGD by shRNA potently inhibits c-Met tyrosine phosphorylation.
22677172 Glycolytic cancer cells lacking 6-phosphogluconate dehydrogenase metabolize glucose to induce senescence
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
21444627 Data suggest that the affinity of Nox2 for NADPH is increased in the presence of 6PGDH on cell stimulation.
20676096 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20675101 Hsa-miR-132 and -212 were negatively correlated with PGD in the prefrontal cortex of individuals affected with schizophrenia and bipolar disorders.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRR      1 - 70
IILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPS     71 - 140
LMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLG    141 - 210
MAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTL    211 - 280
IGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFG    281 - 350
WTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPM    351 - 420
PCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA           421 - 483
//

Text Mined References (32)

PMID Year Title
26479318 2015 6-Phosphogluconate dehydrogenase links oxidative PPP, lipogenesis and tumour growth by inhibiting LKB1-AMPK signalling.
25042803 2014 Lysine acetylation activates 6-phosphogluconate dehydrogenase to promote tumor growth.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24125036 2014 1p36.22 region containing PGD gene is frequently gained in human cervical cancer.
23973484 2013 6-Phosphogluconate dehydrogenase regulates tumor cell migration in vitro by regulating receptor tyrosine kinase c-Met.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22677172 2012 Glycolytic cancer cells lacking 6-phosphogluconate dehydrogenase metabolize glucose to induce senescence.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21444627 2011 Coupling of 6-phosphogluconate dehydrogenase with NADPH oxidase in neutrophils: Nox2 activity regulation by NADPH availability.
21269460 2011 Initial characterization of the human central proteome.
20676096 2010 Genome-wide association study identifies 1p36.22 as a new susceptibility locus for hepatocellular carcinoma in chronic hepatitis B virus carriers.
20675101 2010 MicroRNA expression profiling in the prefrontal cortex of individuals affected with schizophrenia and bipolar disorders.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12498092 [Intensity of pentose phosphate metabolism of carbohydrates in various brain areas in normal and starved animals].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9920387 1998 6-Phosphogluconate dehydrogenase: the mechanism of action investigated by a comparison of the enzyme from different species.
8978909 1996 Identification of a cDNA encoding 6-phosphogluconate dehydrogenase from a human heart cDNA library.
4517931 1973 Regional localization of loci for human PGM and 6PGD on human chromosome one by use of hybrids of Chinese hamster-human somatic cells.
3932573 1985 Limiting role of 6-phosphogluconolactonase in erythrocyte hexose monophosphate pathway metabolism.
3864603 1985 Report of the Committee on the Genetic Constitution of Chromosomes 1 and 2.
3858849 1985 6-Phosphogluconolactonase deficiency, a hereditary erythrocyte enzyme deficiency: possible interaction with glucose-6-phosphate dehydrogenase deficiency.
2283141 1990 PGD phenotyping in bloodstains, organ tissues, dental pulps and hair roots by isoelectric focusing.