Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.55
PubTator Score 2.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Synonym

Accession Q8N414 A0PJF3 B9EK58 Q5SR37 Q6PJN2
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

Gene RIF (1)

PMID Text
26406119 DNA transposition catalyzed by PGBD5 in human cells occurs genome-wide, with precise transposon excision and preference for insertion at TTAA sites.

AA Sequence

MPDYRTRALFVQSTLGDSAGPELQLLSIVPGRDLQPSDSFTGPTRKMPPSASAVDFFQLFVPDNVLKNMV      1 - 70
VQTNMYAKKFQERFGSDGAWVEVTLTEMKAFLGYMISTSISHCESVLSIWSGGFYSNRSLALVMSQARFE     71 - 140
KILKYFHVVAFRSSQTTHGLYKVQPFLDSLQNSFDSAFRPSQTQVLHEPLIDEDPVFIATCTERELRKRK    141 - 210
KRKFSLWVRQCSSTGFIIQIYVHLKEGGGPDGLDALKNKPQLHSMVARSLCRNAAGKNYIIFTGPSITSL    211 - 280
TLFEEFEKQGIYCCGLLRARKSDCTGLPLSMLTNPATPPARGQYQIKMKGNMSLICWYNKGHFRFLTNAY    281 - 350
SPVQQGVIIKRKSGEIPCPLAVEAFAAHLSYICRYDDKYSKYFISHKPNKTWQQVFWFAISIAINNAYIL    351 - 420
YKMSDAYHVKRYSRAQFGERLVRELLGLEDASPTH                                       421 - 455
//

Text Mined References (8)

PMID Year Title
26406119 2015 Genomic DNA transposition induced by human PGBD5.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12955498 2003 Molecular evolutionary analysis of the widespread piggyBac transposon family and related "domesticated" sequences.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.