Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.14
PubTator Score 1.75

Knowledge Summary


No data available


  Disease (1)

Gene RIF (4)

22483866 CSB-PGBD3 fusion protein is important in both health and disease, and could play a role in Cockayne syndrome.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18369450 a domesticated PiggyBac-like transposon PGBD3, residing within intron 5 of the CSB gene, functions as an alternative 3' terminal exon
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

QTRCAECHKNTTFRCEKCDVALHVKCSVEYHTE                                         561 - 593

Text Mined References (13)

PMID Year Title
23369858 What role (if any) does the highly conserved CSB-PGBD3 fusion protein play in Cockayne syndrome?
23028371 2012 Tethering of the conserved piggyBac transposase fusion protein CSB-PGBD3 to chromosomal AP-1 proteins regulates expression of nearby genes in humans.
22483866 2012 The conserved Cockayne syndrome B-piggyBac fusion protein (CSB-PGBD3) affects DNA repair and induces both interferon-like and innate antiviral responses in CSB-null cells.
21143350 2011 Mutant Cockayne syndrome group B protein inhibits repair of DNA topoisomerase I-DNA covalent complex.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18369450 2008 An abundant evolutionarily conserved CSB-PiggyBac fusion protein expressed in Cockayne syndrome.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12955498 2003 Molecular evolutionary analysis of the widespread piggyBac transposon family and related "domesticated" sequences.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.