Property Summary

NCBI Gene PubMed Count 16
PubMed Score 29.44
PubTator Score 9.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Hyperphosphatasia with Mental Retardation 5 0.0 0.0
Disease Target Count P-value
ulcerative colitis 1819 1.2e-06
osteosarcoma 7950 2.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Intellectual disability 1016 3.132 1.6
Disease Target Count Z-score Confidence
Retinitis pigmentosa 23 27 3.726 1.9
Opioid abuse 5 3.237 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.046 2.1e-04
ulcerative colitis -1.100 1.2e-06

Gene RIF (10)

AA Sequence

MAGLAARLVLLAGAAALASGSQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAGWTCRDDCKY      1 - 70
ECMWVTVGLYLQEGHKVPQFHGKWPFSRFLFFQEPASAVASFLNGLASLVMLCRYRTFVPASSPMYHTCV     71 - 140
AFAWVSLNAWFWSTVFHTRDTDLTEKMDYFCASTVILHSIYLCCVRTVGLQHPAVVSAFRALLLLMLTVH    141 - 210
VSYLSLIRFDYGYNLVANVAIGLVNVVWWLAWCLWNQRRLPHVRKCVVVVLLLQGLSLLELLDFPPLFWV    211 - 280
LDAHAIWHISTIPVHVLFFSFLEDDSLYLLKESEDKFKLD                                  281 - 320
//

Text Mined References (19)

PMID Year Title