Property Summary

NCBI Gene PubMed Count 14
PubMed Score 12.55
PubTator Score 9.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma -2.249 6.9e-06
astrocytic glioma 1.500 1.7e-02
Astrocytoma, Pilocytic 1.400 1.6e-04
atypical teratoid / rhabdoid tumor 1.200 4.4e-02
Breast cancer -1.400 9.1e-05
Crohn's disease -1.177 1.1e-02
diabetes mellitus -1.200 4.5e-03
ependymoma 1.400 3.5e-02
glioblastoma 1.400 6.2e-04
group 3 medulloblastoma 1.800 9.7e-03
interstitial cystitis -1.900 4.9e-04
lung adenocarcinoma -1.200 1.6e-12
lung cancer 1.800 7.3e-05
medulloblastoma, large-cell 1.300 1.8e-03
nasopharyngeal carcinoma 1.500 1.2e-02
non primary Sjogren syndrome sicca -1.100 1.1e-02
oligodendroglioma 1.800 1.3e-02
osteosarcoma 1.230 3.0e-02
ovarian cancer -1.400 6.9e-03
pediatric high grade glioma 1.200 3.1e-04
primitive neuroectodermal tumor 1.200 1.2e-02
psoriasis -1.200 2.3e-03
tuberculosis -3.000 1.2e-07
ulcerative colitis -1.373 1.5e-02

Gene RIF (5)

AA Sequence

MFLHSVNLWNLAFYVFMVFLATLGLWDVFFGFEENKCSMSYMFEYPEYQKIELPKKLAKRYPAYELYLYG      1 - 70
EGSYAEEHKILPLTGIPVLFLPGNAGSYKQVRSIGSIALRKAEDIDFKYHFDFFSVNFNEELVALYGGSL     71 - 140
QKQTKFVHECIKTILKLYKGQEFAPKSVAIIGHSMGGLVARALLTLKNFKHDLINLLITQATPHVAPVMP    141 - 210
LDRFITDFYTTVNNYWILNARHINLTTLSVAGGFRDYQVRSGLTFLPKLSHHTSALSVVSSAVPKTWVST    211 - 280
DHLSIVWCKQLQLTTVRAFFDLIDADTKQITQNSKKKLSVLYHHFIRHPSKHFEENPAIISDLTGTSMWV    281 - 350
LVKVSKWTYVAYNESEKIYFTFPLENHRKIYTHVYCQSTMLDTNSWIFACINSTSMCLQGVDLSWKAELL    351 - 420
PTIKYLTLRLQDYPSLSHLVVYVPSVRGSKFVVDCEFFKKEKRYIQLPVTHLFSFGLSSRKVVLNTNGLY    421 - 490
YNLELLNFGQIYQAFKINVVSKCSAVKEEITSIYRLHIPWSYEDSLTIAQAPSSTEISLKLHIAQPENNT    491 - 560
HVALFKMYTSSDCRYEVTVKTSFSQILGQVVRFHGGALPAYVVSNILLAYRGQLYSLFSTGCCLEYATML    561 - 630
DKEAKPYKVDPFVIIIKFLLGYKWFKELWDVLLLPELDAVILTCQSMCFPLISLILFLFGTCTAYWSGLL    631 - 700
SSASVRLLSSLWLALKRPSELPKDIKMISPDLPFLTIVLIIVSWTTCGALAILLSYLYYVFKVVHLQASL    701 - 770
TTFKNSQPVNPKHSRRSEKKSNHHKDSSIHHLRLSANDAEDSLRMHSTVINLLTWIVLLSMPSLIYWLKN    771 - 840
LRYYFKLNPDPCKPLAFILIPTMAILGNTYTVSIKSSKLLKTTSQFPLPLAVGVIAFGSAHLYRLPCFVF    841 - 910
IPLLLHALCNFM                                                              911 - 922
//

Text Mined References (15)

PMID Year Title