Property Summary

NCBI Gene PubMed Count 15
PubMed Score 16.59
PubTator Score 11.76

Knowledge Summary

Patent

No data available

Expression

 GO Process (1)

Gene RIF (9)

PMID Text
26381214 Results identify a crucial role for RIPK3-PGAM5-Drp1/NFAT signalling in NKT cell activation, and further suggest that RIPK3-PGAM5 signalling may mediate crosstalk between mitochondrial function and immune signalling.
26356820 Results indicate that a multiprotein complex including PGAM5, Bax and Drp1 proteins specifically formed during intrinsic apoptosis induction.
25126723 The BCL2L1-PGAM5-FUNDC1 axis is critical for receptor-mediated mitophagy.
24746696 Dephosphorylation of FUNDC1 by PGAM5 induces mitophagy.
23201124 PGAM5 is proteolytically processed, accumulates in the cytosol during apoptosis, and sensitizes cells to death.
22915595 Rhomboid protease PARL mediates the mitochondrial membrane potential loss-induced cleavage of PGAM5.
22265414 Experimental data indicate that the two splice variants of the mitochondrial protein phosphatase PGAM5 are at the convergent point of multiple necrosis pathways.
19590015 Results suggest that this member of the PGAM family has crossed over from small molecules to protein substrates and been adapted to serve as a specialized activator of ASK1.
17046835 The N terminus of the PGAM5 protein contains a conserved NXESGE motif that binds to the substrate binding pocket in the Kelch domain of Keap1.

AA Sequence

MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSL      1 - 70
INVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGL     71 - 140
KFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRN    141 - 210
YIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGF    211 - 280
MPPDKITRS                                                                 281 - 289
//

Text Mined References (23)

PMID Year Title
26381214 2015 Regulation of NKT cell-mediated immune responses to tumours and liver inflammation by mitochondrial PGAM5-Drp1 signalling.
26356820 2015 Bax-PGAM5L-Drp1 complex is required for intrinsic apoptosis execution.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25126723 2014 The BCL2L1 and PGAM5 axis defines hypoxia-induced receptor-mediated mitophagy.
24746696 2014 A regulatory signaling loop comprising the PGAM5 phosphatase and CK2 controls receptor-mediated mitophagy.
23201124 2013 Substrates of IAP ubiquitin ligases identified with a designed orthogonal E3 ligase, the NEDDylator.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22915595 2012 Rhomboid protease PARL mediates the mitochondrial membrane potential loss-induced cleavage of PGAM5.
22265414 2012 The mitochondrial phosphatase PGAM5 functions at the convergence point of multiple necrotic death pathways.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19590015 2009 Mitochondrial phosphoglycerate mutase 5 uses alternate catalytic activity as a protein serine/threonine phosphatase to activate ASK1.
18387606 2008 PGAM5 tethers a ternary complex containing Keap1 and Nrf2 to mitochondria.
17046835 2006 PGAM5, a Bcl-XL-interacting protein, is a novel substrate for the redox-regulated Keap1-dependent ubiquitin ligase complex.
16541075 2006 The finished DNA sequence of human chromosome 12.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11283018 2001 In vitro selection and characterization of Bcl-X(L)-binding proteins from a mix of tissue-specific mRNA display libraries.
7584027 1994 An expression profile of active genes in human colonic mucosa.