Property Summary

NCBI Gene PubMed Count 8
PubMed Score 8.08
PubTator Score 4.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cowpox 16 4.399 2.2
Nephrolithiasis 55 3.82 1.9

Expression

Gene RIF (1)

AA Sequence

MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRHTFLQAGLSVGGRR      1 - 70
CCVIRDHLLAEGDGVLDARTKGLDARAVCVGRAPRALLVLMGRRGVHGGILNKTVHELIRGLRMQGA        71 - 137
//

Text Mined References (9)

PMID Year Title