Property Summary

NCBI Gene PubMed Count 50
PubMed Score 74.74
PubTator Score 22.40

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (2)

Gene RIF (16)

PMID Text
26205495 The crystallized PFKP is permanently activated by a deletion of the 22 C-terminal residues.
24331211 Anti-human protein S antibody induces tissue factor expression through a direct interaction with PFKP and ERK1/2 activation in coronary artery endothelial cells.
23389994 expression of TARDBP is significantly elevated in HCC and it regulates the expression of PFKP, the rate-limiting enzyme for glycolysis, through negative regulation of microRNA 520s (miR-520s).
23166591 Expression of HIV-1 Tat upregulates the abundance of phosphofructokinase (PFKP; platelet) in the nucleoli of Jurkat T-cells
22174317 Expression of HIV-1 Tat upregulates the abundance of phosphofructokinase (PFKP; platelet) in the nucleoli of Jurkat T-cells
21586797 KLF4 plays a role in maintenance of high glycolytic metabolism by transcriptional activation of the PFKP gene in breast cancer cells.
20712903 Observational study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18682847 PFKP polymorphisms play no apparent role in the development of common forms of obesity in the Danish population.
18682847 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17658951 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
17544406 Two phosphofructokinase (PFK) chimeras were constructed by exchanging the N- and C-terminal halves of the mammalian M- and C-type isozymes.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15716112 The transcription start point was determined at 48 bp upstream of the start codon. the region -65 to +48 turned out to be sufficient for promoter activity
12438565 PFKP was identified using a trifunctional phenyl sulfonate probe.

AA Sequence

MDADDSRAPKGSLRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIYEGYQGMVDG      1 - 70
GSNIAEADWESVSSILQVGGTIIGSARCQAFRTREGRLKAACNLLQRGITNLCVIGGDGSLTGANLFRKE     71 - 140
WSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQR    141 - 210
TFVLEVMGRHCGYLALVSALACGADWVFLPESPPEEGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQN    211 - 280
KPITSEKIKELVVTQLGYDTRVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLNGN    281 - 350
HAVRLPLMECVQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGA    351 - 420
PAAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTKRVLPGKYLEE    421 - 490
IATQMRTHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVSNNVPGSDFSIGADTALNTIT    491 - 560
DTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADAAYIFEEPFDIRDLQSNVEHLTEKMKTTI    561 - 630
QRGLVLRNESCSENYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITAK    631 - 700
LKEARGRGKKFTTDDSICVLGISKRNVIFQPVAELKKQTDFEHRIPKEQWWLKLRPLMKILAKYKASYDV    701 - 770
SDSGQLEHVQPWSV                                                            771 - 784
//

Text Mined References (60)

PMID Year Title
27058317 2016 Metabolic reprogramming during neuronal differentiation.
27049827 2016 The platelet isoform of phosphofructokinase contributes to metabolic reprogramming and maintains cell proliferation in clear cell renal cell carcinoma.
26980488 2016 Genetic alteration in phosphofructokinase family promotes growth of muscle-invasive bladder cancer.
26458310 2015 Identification of lung cancer oncogenes based on the mRNA expression and single nucleotide polymorphism profile data.
26205495 2015 Crystal structure of human platelet phosphofructokinase-1 locked in an activated conformation.
25985179 2015 Structures of human phosphofructokinase-1 and atomic basis of cancer-associated mutations.
25932951 2015 Comprehensive analysis of glycolytic enzymes as therapeutic targets in the treatment of glioblastoma.
25859558 2015 Analysis and interpretation of transcriptomic data obtained from extended Warburg effect genes in patients with clear cell renal cell carcinoma.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24331211 2014 Anti-human protein S antibody induces tissue factor expression through a direct interaction with platelet phosphofructokinase.
24260065 2013 Differential phosphofructokinase-1 isoenzyme patterns associated with glycolytic efficiency in human breast cancer and paracancer tissues.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23389994 2013 Tat-activating regulatory DNA-binding protein regulates glycolysis in hepatocellular carcinoma by regulating the platelet isoform of phosphofructokinase through microRNA 520.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22993228 2013 Novel genetic variants associated with lumbar disc degeneration in northern Europeans: a meta-analysis of 4600 subjects.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21586797 2011 Krüppel-like factor 4 (KLF4) activates the transcription of the gene for the platelet isoform of phosphofructokinase (PFKP) in breast cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20712903 2010 Obesity and diabetes genes are associated with being born small for gestational age: results from the Auckland Birthweight Collaborative study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18682847 2008 Non-replication of genome-wide based associations between common variants in INSIG2 and PFKP and obesity in studies of 18,014 Danes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17658951 2007 Genome-wide association scan shows genetic variants in the FTO gene are associated with obesity-related traits.
17544406 2007 Chimeric phosphofructokinases involving exchange of the N- and C-terminal halves of mammalian isozymes: implications for ligand binding sites.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15716112 2005 Characterization of the human P-type 6-phosphofructo-1-kinase gene promoter in neural cell lines.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14760703 2004 Proteomic identification of brain proteins that interact with dynein light chain LC8.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12963966 2003 Cloning and chromosomal characterization of the 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase-3 gene (PFKFB3, iPFK2).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438565 2002 Trifunctional chemical probes for the consolidated detection and identification of enzyme activities from complex proteomes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8117307 1994 Cloning of a complete protein-coding sequence of human platelet-type phosphofructokinase isozyme from pancreatic islet.
7825568 1995 Functional expression of human mutant phosphofructokinase in yeast: genetic defects in French Canadian and Swiss patients with phosphofructokinase deficiency.
6451249 1981 Isozymes of human phosphofructokinase in blood cells and cultured cell lines: molecular and genetic evidence for a trigenic system.
6444721 1980 Isozymes of human phosphofructokinase: identification and subunit structural characterization of a new system.
2960695 1987 Characterization of the enzymatic defect in late-onset muscle phosphofructokinase deficiency. New subtype of glycogen storage disease type VII.
2822475 1987 Cloning of human muscle phosphofructokinase cDNA.
1834056 1991 Isolation and sequence of a cDNA encoding human platelet phosphofructokinase.
1533608 1992 Regional chromosomal assignment of the human platelet phosphofructokinase gene to 10p15.
156693 1979 Phosphofructokinase (PFK) isozymes in man. I. Studies of adult human tissues.
156568 1979 Phosphofructokinase in human blood cells.