Property Summary

NCBI Gene PubMed Count 18
PubMed Score 17.84
PubTator Score 17.41

Knowledge Summary

Patent (886)

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 2.7e-09
ductal carcinoma in situ 1745 1.4e-03
invasive ductal carcinoma 2950 2.2e-02

Expression

  Differential Expression (3)

Disease log2 FC p
ductal carcinoma in situ -1.700 1.4e-03
invasive ductal carcinoma -1.600 2.2e-02
ovarian cancer 1.100 2.7e-09

Gene RIF (3)

PMID Text
26827442 Insulin resistance in obese boys leads to up-regulation of INSIG2 gene expression as well as to down-regulation of PFKFB1, PFKFB3, and HK2 genes in the blood cells as compared to obese patients with normal insulin sensitivity.
19474452 Observational study of genetic testing. (HuGE Navigator)
12379646 Results describe structural differences between two isozymes of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase from liver and testis.

AA Sequence

MSPEMGELTQTRLQKIWIPHSSGSSRLQRRRGSSIPQFTNSPTMVIMVGLPARGKTYISTKLTRYLNWIG      1 - 70
TPTKVFNLGQYRREAVSYKNYEFFLPDNMEALQIRKQCALAALKDVHNYLSHEEGHVAVFDATNTTRERR     71 - 140
SLILQFAKEHGYKVFFIESICNDPGIIAENIRQVKLGSPDYIDCDREKVLEDFLKRIECYEVNYQPLDEE    141 - 210
LDSHLSYIKIFDVGTRYMVNRVQDHIQSRTVYYLMNIHVTPRSIYLCRHGESELNIRGRIGGDSGLSVRG    211 - 280
KQYAYALANFIQSQGISSLKVWTSHMKRTIQTAEALGVPYEQWKALNEIDAGVCEEMTYEEIQEHYPEEF    281 - 350
ALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKSSDELPYLKCPLH    351 - 420
TVLKLTPVAYGCKVESIYLNVEAVNTHREKPENVDITREPEEALDTVPAHY                       421 - 471
//

Text Mined References (20)

PMID Year Title
26827442 [EXPRESSION OF GENES, WHICH CONTROL GLUCOSE METABOLISM, IN BLOOD CELLS OF THE OBESE BOYS WITH INSULIN RESISTANCE].
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
19474452 2009 Perioperative genomic profiles using structure-specific oligonucleotide probes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12721358 2003 A humble hexose monophosphate pathway metabolite regulates short- and long-term control of lipogenesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12379646 2003 Tissue-specific structure/function differentiation of the liver isoform of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase.
11522786 2001 Characterization of glucokinase-binding protein epitopes by a phage-displayed peptide library. Identification of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase as a novel interaction partner.
10222032 1999 cDNA sequence and kinetic properties of human lung fructose(1, 6)bisphosphatase.
10095107 1999 Cloning, expression and chromosomal localization of a human testis 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase gene.
9464277 1998 Expression of human placental-type 6-phosphofructo-2-kinase/fructose 2,6-bisphosphatase in various cells and cell lines.
9119406 1997 Localization of human liver 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB1) within a YAC contig in Xp11.21.
7574501 1995 6-Phosphofructo-2-kinase/fructose-2,6-bisphosphatase: a metabolic signaling enzyme.
2837207 1988 Molecular cloning, sequence analysis, and expression of a human liver cDNA coding for fructose-6-P,2-kinase:fructose-2,6-bisphosphatase.
2540168 1989 Glucocorticoid regulation of hepatic 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase gene expression.
2163524 1990 Sequence of human liver 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase.