Property Summary

NCBI Gene PubMed Count 19
PubMed Score 9.27
PubTator Score 85.30

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
23720755 knockdown of PFD2 and PFD5 disrupted prefoldin formation in HTT-expressing cells, resulting in accumulation of aggregates of a pathogenic form of HTT and in induction of cell death.
22844532 Rabring7 stimulates c-Myc degradation via mono-ubiquitination of MM-1
18398700 MM-1, a c-Myc interacting protein, interacts with HCV ARFP/F protein, which can result in the enhancement of the c-Myc activity.
18281035 Wnt4 gene, a member of the Wnt-beta-catenin pathway, was identified as a target gene of MM-1.
16173081 MM-1alpha, MM-1gamma, and MM-1gamma, but not MM-1beta, were found to repress transcription activity of c-Myc
11844794 interaction with p73

AA Sequence

MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSM      1 - 70
YVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQ     71 - 140
QLTALGAAQATAKA                                                            141 - 154
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23720755 2013 Prefoldin protects neuronal cells from polyglutamine toxicity by preventing aggregation formation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22844532 2012 Rabring7 degrades c-Myc through complex formation with MM-1.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18398700 2008 Hepatitis C virus ARFP/F protein interacts with cellular MM-1 protein and enhances the gene trans-activation activity of c-Myc.
18281035 2008 Negative regulation of the Wnt signal by MM-1 through inhibiting expression of the wnt4 gene.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17728244 2007 Stimulation of c-Myc transcriptional activity by vIRF-3 of Kaposi sarcoma-associated herpesvirus.
16541075 2006 The finished DNA sequence of human chromosome 12.
16173081 2006 Distinct localizations and repression activities of MM-1 isoforms toward c-Myc.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11844794 2002 Physical interaction of p73 with c-Myc and MM1, a c-Myc-binding protein, and modulation of the p73 function.
11567024 2001 MM-1, a c-Myc-binding protein, is a candidate for a tumor suppressor in leukemia/lymphoma and tongue cancer.
10542082 1999 A chaperone with a hydrophilic surface.
10209023 1999 Prefoldin-nascent chain complexes in the folding of cytoskeletal proteins.
9792694 1998 MM-1, a novel c-Myc-associating protein that represses transcriptional activity of c-Myc.
9630229 1998 Prefoldin, a chaperone that delivers unfolded proteins to cytosolic chaperonin.