Property Summary

NCBI Gene PubMed Count 19
PubMed Score 6.31
PubTator Score 4.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.300 2.2e-02
Breast cancer 1.500 2.0e-06
ependymoma -1.300 4.6e-02
intraductal papillary-mucinous adenoma (... 1.100 2.0e-03
lung cancer 1.400 1.3e-04
Multiple myeloma 1.267 3.1e-03
ovarian cancer 2.200 7.3e-06
primary pancreatic ductal adenocarcinoma 1.040 7.1e-03

Synonym

Accession Q9UHV9 Q9P0P7 Q9UN05
Symbols PFD2

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

Gene RIF (3)

AA Sequence

MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKC      1 - 70
YRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSE     71 - 140
GAGAKASSAGVLVS                                                            141 - 154
//

Text Mined References (20)

PMID Year Title