Property Summary

NCBI Gene PubMed Count 22
PubMed Score 8.54
PubTator Score 5.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
non primary Sjogren syndrome sicca 840 1.8e-02

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 1.8e-02

Synonym

Accession O60925 B2RD02 Q53F95 Q96EX6
Symbols PDF
PFD1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
26553318 Studied PFDN1 as prognosis indicator for colorectal cancer and investigated the functions of PFDN1 in colorectal cancer.
16415341 antagonistic actions of PhLP3 and prefoldin serve to modulate CCT activity and play a key role in establishing a functional cytoskeleton in vivo

AA Sequence

MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFIL      1 - 70
QSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ                       71 - 122
//

Text Mined References (24)

PMID Year Title
26553318 2015 PFDN1, an indicator for colorectal cancer prognosis, enhances tumor cell proliferation and motility through cytoskeletal reorganization.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16876117 2006 Interaction of hepatitis C virus F protein with prefoldin 2 perturbs tubulin cytoskeleton organization.
16415341 2006 PhLP3 modulates CCT-mediated actin and tubulin folding via ternary complexes with substrates.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14634002 2004 Selective contribution of eukaryotic prefoldin subunits to actin and tubulin binding.
14615539 2003 Control of nutrient-sensitive transcription programs by the unconventional prefoldin URI.
12748950 2003 Proteomic study of human umbilical vein endothelial cells in culture.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456645 2002 Structure of eukaryotic prefoldin and of its complexes with unfolded actin and the cytosolic chaperonin CCT.
11884745 2002 Molecular chaperones in the cytosol: from nascent chain to folded protein.
11535601 2001 Prefoldin recognition motifs in the nonhomologous proteins of the actin and tubulin families.
11521196 2001 Expression, cellular distribution and protein binding of the glioma amplified sequence (GAS41), a highly conserved putative transcription factor.
10542082 1999 A chaperone with a hydrophilic surface.
10209023 1999 Prefoldin-nascent chain complexes in the folding of cytoskeletal proteins.
10191080 1999 A radiation hybrid breakpoint map of the acute myeloid leukemia (AML) and limb-girdle muscular dystrophy 1A (LGMD1A) regions of chromosome 5q31 localizing 122 expressed sequences.
9630229 1998 Prefoldin, a chaperone that delivers unfolded proteins to cytosolic chaperonin.
8744932 1996 Cloning of cDNA with possible transcription factor activity at the G1-S phase transition in human fibroblast cell lines.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.