Property Summary

NCBI Gene PubMed Count 19
PubMed Score 21.78
PubTator Score 16.13

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
24469069 CXCL4 and CXCL4L1 activated p38 MAPK, as well as Src kinase within 30 and 5 min, respectively. Extracellular signal-regulated kinase (ERK) phosphorylation occurred in activated lymphocytes.
23747987 Fibstatin and CXCL4L1 cooperate to inhibit endothelial cell proliferation, migration and tubulogenesis in vitro.
23747987 fibstatin and CXCL4L1 have cooperative roles in inhibition of tumor invasion in lymph nodes
23536183 Structural insight into the novel functional properties of human CXCL4L1.
22384011 PF-4var/CXCL4L1 predicts outcome in stable coronary artery disease patients with preserved left ventricular function
21111666 Current knowledge on the role of CXCL4/PF-4 and CXCL4L1/PF-4var in physiological and pathological processes.
20980681 both CXCR3A and CXCR3B are implicated in the chemotactic and vascular effects of CXCL4L1.
20961394 CXCL4L1 may act angiostatically causing random endothelial cell locomotion, disturbing directed migration towards angiogenic chemokines, serving as a homeostatic chemokine with moderate structural distinction yet different functional profile from CXCL4.
20688960 The study determines the binding parameters of CXCL4 and CXCL4L1 for heparin, heparan sulfate, and chondroitin sulfate B.
20237496 Observational study of gene-disease association. (HuGE Navigator)
18563170 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSSAARSRLTRATRQEMLFLALLLLPVVVAFARAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHC      1 - 70
PTAQLIATLKNGRKICLDLQALLYKKIIKEHLES                                         71 - 104
//

Text Mined References (20)

PMID Year Title
25711636 2015 The Chemokine Platelet Factor-4 Variant (PF-4var)/CXCL4L1 Inhibits Diabetes-Induced Blood-Retinal Barrier Breakdown.
25466649 2015 The roles and potential therapeutic implications of CXCL4 and its variant CXCL4L1 in the pathogenesis of chronic liver allograft dysfunction.
25373734 2014 Angiostatic, tumor inflammatory and anti-tumor effects of CXCL4(47-70) and CXCL4L1(47-70) in an EGF-dependent breast cancer model.
24469069 2014 CXCL4L1 and CXCL4 signaling in human lymphatic and microvascular endothelial cells and activated lymphocytes: involvement of mitogen-activated protein (MAP) kinases, Src and p70S6 kinase.
23747987 2013 CXCL4L1-fibstatin cooperation inhibits tumor angiogenesis, lymphangiogenesis and metastasis.
23536183 2013 Alternative C-terminal helix orientation alters chemokine function: structure of the anti-angiogenic chemokine, CXCL4L1.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22384011 2012 PF-4var/CXCL4L1 predicts outcome in stable coronary artery disease patients with preserved left ventricular function.
21111666 2011 The role of the CXC chemokines platelet factor-4 (CXCL4/PF-4) and its variant (CXCL4L1/PF-4var) in inflammation, angiogenesis and cancer.
20980681 2011 Angiostatic and chemotactic activities of the CXC chemokine CXCL4L1 (platelet factor-4 variant) are mediated by CXCR3.
20961394 2011 CXCL4L1 inhibits angiogenesis and induces undirected endothelial cell migration without affecting endothelial cell proliferation and monocyte recruitment.
20688960 2010 Functional divergence between 2 chemokines is conferred by single amino acid change.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18563170 2008 Modulation of cystic fibrosis lung disease by variants in interleukin-8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459074 2004 Platelets release CXCL4L1, a nonallelic variant of the chemokine platelet factor-4/CXCL4 and potent inhibitor of angiogenesis.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
2725510 1989 Identification and characterization of PF4varl, a human gene variant of platelet factor 4.
1695112 1990 Structural and functional comparison of the genes for human platelet factor 4 and PF4alt.