Property Summary

NCBI Gene PubMed Count 159
PubMed Score 2045.54
PubTator Score 1161.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
gastric cancer 1.500 3.8e-03
hepatocellular carcinoma 1.300 2.5e-03
pancreatic cancer 2.000 7.5e-04
malignant mesothelioma -1.400 3.4e-06
osteosarcoma -3.761 8.6e-04
non-small cell lung cancer -1.235 9.1e-12
ulcerative colitis 1.900 8.3e-05
pancreatic carcinoma 2.000 7.5e-04
mucosa-associated lymphoid tissue lympho... 1.776 3.2e-02

Gene RIF (116)

PMID Text
26810286 Expression of CXCL4 and aquaporin 3 and 10 mRNAs in middle ear effusion is associated with the pathophysiology of otitis media with effusion.
26524462 Results found that CXCL4 plasma levels did not differ between patients with and without coronary artery disease. Also, no association between CXCL4 levels and plaque characteristics including plaque volume, calcium score, or vascular remodeling.
26291604 A subset of heparin-treated patients produce subthreshold levels of platelet-activating anti-PF4/heparin antibodies that do not cause heparin-induced thrombocytopenia.
26256688 PF4 has a complex intramedullary life cycle with important implications in megakaryopoiesis and hematopoietic stem cell replication not seen with other tested alpha granule proteins.
26225544 PF4 changed its structure upon binding to polyP in a similar way as seen in PF4/heparin complexes. PF4/polyP complexes exposed neoepitopes to which human anti-PF4/heparin antibodies bound.
26142741 Data suggest that, in patients with hypothyroid autoimmune thyroiditis, PF4/CXCL4 serum levels are significantly lower in those with subclinical hypothyroidism than in euthyroid control subjects.
25960020 Heparin enhances antigen uptake and activation of the initial steps in the cellular immune response to PF4-containing complexes.
25858640 Synovial Cxcl4 mRNA and protein were increased in early rheumatoid arthritis compared to uninflamed controls and resolving arthritis.
25604035 PF4-heparin complexes can elicit a TLR4-mediated response, suggesting that these complexes can mimic a pathogen-associated molecular pattern, and supporting the suggestion that the HIT immune response represents a misdirected host defense mechanism.
25342714 although all HIT antibodies recognize PF4 in a complex with heparin, only a subset of these antibodies recognize more subtle epitopes induced in PF4 when it binds to CS, the major platelet glycosaminoglycan
25159325 Data suggest that healthy adult stem cells exposed to vitreous/aqueous humors of subjects with proliferative diabetic retinopathy results in increased expression of CXCL4, serpin F1, and endothelin-1 (aqueous only).
25150299 The interaction of PF4 with unfractionated heparin (UFH), its 16-, 8-, and 6-mer subfractions, low-molecular-weight heparin (LMWH), and the pentasaccharide fondaparinux, was characterized.
24665827 effective for prediction of the risk of thrombosis in hemodialysis patients
24534089 eutopic endometrial stromal cells from deep infiltrating endometriosis patients are attracted into the peritoneal cavity through the interaction between CXCR4 expressed on their membrane and CXCL12 produced in the peritoneal cavity.
24469069 CXCL4 and CXCL4L1 activated p38 MAPK, as well as Src kinase within 30 and 5 min, respectively. Extracellular signal-regulated kinase (ERK) phosphorylation occurred in activated lymphocytes.
24177324 Histones regulate activated protein C formation in a manner similar to PF4 and suggest heparinoids may be benificial in sepsis.
24097975 Distinct specificity and single-molecule kinetics characterize the interaction of pathogenic and non-pathogenic antibodies against platelet factor 4-heparin complexes with platelet factor 4.
24023389 Platelet factor 4 has significant crosstalk with vascular endothelial growth factor by modulating cell migration and signal transduction pathways.
23848403 RUNX1, but not its mutants, strongly and synergistically activates PF4 expression along with ETS family proteins
23769097 physical relationship between the PF4-positive thrombi and the heparin-coated surface suggests that onset of HIT II could be influenced by the immobilized heparin coating
23701307 Plasma VEGF was significantly reduced in low birth weight (LBW) neonates while that of sVEGFR-1 and PF4 were significantly higher. VEGF/sVEGF/PF4 pathway seems to be involved in the endothelial progenitor cell dysfunction in LBW neonates.
23634812 Release of CXCL4 by activated platelets inhibits HIV-1 infection of adjacent T cells at the stage of virus entry.
23621699 certain genotypes of ACP1 associated with high phosphatase activity may increase the T-cell response to PF4-heparin complexes, with higher levels of circulating antibodies
23611535 Baseline PF4 and beta-TG plasma levels were found remarkably higher and no significant reduction was observed at the endpoint in patients with residual major depression
23352833 This study aimed at examining the presence and role of chemokines (angiogenic CCL2/MCP-1 and angiostatic CXCL4/PF-4, CXCL9/Mig, CXCL10/IP-10) in proliferative diabetic retinopathy.
23245326 Platelet factor 4 exhibits antimicrobial activity against Plasmodium falciparum.
23224555 platelet molecule platelet factor 4 (PF4 or CXCL4) and the erythrocyte Duffy-antigen receptor (Fy) are necessary for platelet-mediated killing of Plasmodium falciparum parasites.
23216710 Anti-PF4/heparin IgG antibodies generated after coronary artery bypass grafting are associated with early venous graft occlusion.
22763266 This study highlights the importance of PF4 variants in the regulation of platelet activation (PF4) and systemic inflammation (tumor necrosis factor-alpha) serum biomarkers.
22740477 Examined the prognostic values of SARS-associated proteome, and deciphered the identities of those with prognostic values.The associations of decreased serum PF4 and increased serum beta-TG levels with poor prognosis were confirmed by Western blot.
22682144 The present review describes the role of CXCL4-PF4 in cancer, the immunobiology, clinical presentation and diagnosis of HIT, and the specific problems faced in cancer patients.
22645343 blockade of HIV-1 infection occurs at the level of virus attachment and entry via a unique mechanism that involves direct interaction of CXCL4 with the major viral envelope glycoprotein, gp120
22645343 CXCL4 directly interacts with HIV-1 gp120 and the CXCL4-binding site is located within the gp120 outer domain (residues 350-455) proximal to the CD4-binding site
22577175 Differences in the properties of anti-PF4 antibodies that cause thrombocytopenia not revealed by ELISA that correlate with oligomerization of PF4 and sustained high-avidity interactions that may simulate transient antibody-antigen interactions in vivo.
22555803 CXCL4 insufficiency may be involved in specific inflammatory microenvironment of ovarian cancers arising in endometriosis.
22402885 VEGF, PF4 and PDGF are elevated in platelets of colorectal cancer patients
22318669 ODSH can be used concurrently with UFH to disrupt PF4/H charge interactions
22235911 Report ability of enoxaparin-derived oligosaccharides to induce platelet activation and exposure of platelet-factor 4 epitopes recognized by antibodies developed in heparin induced thrombocytopenia.
22088491 In conclusion, measurements of HIT-IgG -specific antibodies can facilitate an appropriate estimation in hemodialysis patients of whether the clinical features of an acute systemic reaction are caused by HIT or dialytic complications.
21931859 Expression of FLI-1, ELF-1, and GABP activated the PF4 promoter in HepG2 cells.
21693026 Our findings indicate that PF4 or p17-70 could be valuable in combating multiple myeloma by disrupting tumor angiogenesis.
21508508 CXCL4 and CXCL10 play a prominent role in pathogenesis of cerebral malaria (CM) associated death and may be used as functional or surrogate biomarkers for predicting CM severity
21129147 results provide the first evidence that PF4 is regulated by RUNX1 and that impaired transcriptional regulation leads to the PF4 deficiency associated with RUNX1 haplodeficiency
21111666 Current knowledge on the role of CXCL4/PF-4 and CXCL4L1/PF-4var in physiological and pathological processes.
21088050 these results stress a co-ordinating role for CXCL4 in the cross-talk between platelets and monocytes during early inflammation.
21041299 PF4 is shown to inhibit activation of TAFI by thrombin-thrombomodulin
20979952 Letter: Report that hemodialysis is not a risk factor for developing heparin-induced thrombocytopenia or antiheparin-PF4 antibodies.
20961394 CXCL4L1 may act angiostatically causing random endothelial cell locomotion, disturbing directed migration towards angiogenic chemokines, serving as a homeostatic chemokine with moderate structural distinction yet different functional profile from CXCL4.
20688960 The study determines the binding parameters of CXCL4 and CXCL4L1 for heparin, heparan sulfate, and chondroitin sulfate B.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20626620 analysis of platelet factor 4/heparin antigen in heparin-induced thrombocytopenia
20539902 Evaluation of a new automated panel of assays for the detection of anti-PF4/heparin antibodies in patients suspected of having heparin-induced thrombocytopenia.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20185595 In hemodialysis patients who have type 2 diabetes and are treated with acetylsalicylic acid, PF4-heparin complex antibodies are associated with sudden and all-cause death.
20182908 the platelet content of VEGF-A in cancer patients was significantly increased compared to healthy controls, while thrombospondin-1, CXCL12 and CXCL4 were significantly decreased
20104488 CXCL4 induces SphK1 enzyme activity as well as its translocation to the cell membrane.
20050998 Type/circumstances of surgery, timing of first anticoagulant dose and BMI influence risk of anti-PF4/heparin antibody formation, consistent with a stoichiometry-based immunization model of PF4 and anticoagulant ratios during early peri-operative period.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19911252 Heparin-PF4 antibodies are present in 10.8% of medical, neurotrauma, or shock-trauma intensive care patients at admission and increase significantly to 29.2% within 7 days.
19910578 CXCL4 may promote atherogenesis by suppressing CD163 in macrophages, which are then unable to upregulate the atheroprotective enzyme heme oxygenase-1 in response to hemoglobin.
19805618 Beta2GPI forms stable complexes with PF4, leading to the stabilization of beta2GPI dimeric structure that facilitates the antibody recognition.
19773294 facilitates macrophage infection with HIV-1 and potentiates virus replication
19750196 Intracellular PF4 content in myeloid DCs and plasmocytoid DCs was significantly elevated in trauma patients compared with healthy controls. HLA-DR on MDCs was significantly elevated on d 1 and d 4 after trauma in patients compared with controls.
19625657 Platelet-derived chemokine CXCL4 protects cathelicidin LL-37 from cleavage by beta-tryptase released from lung-derived mast cells.
19470732 MALDI-TOF MS-based serum peptidome profiling allowed the discovery and validation of platelet factor 4 as a new discriminating marker in pancreatic cancer.
19397833 Our data therefore suggest that seroconversion for HIT antibodies generated by heparin is associated with a risk of DVT in patients undergoing total joint replacement.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19245795 NMR results identified the amino-acid residues involved in the direct interaction of CXCL4 (47-70) with FGF-2.
19201759 released predominantly by the luminal thrombus pole of abdominal aortic aneurysm intraluminal thrombus
18797178 increased plasma levels in patients with atopic dermatitis and psoriasis, correlate with disease severity scores
18648521 human umbilical vein endothelial cells adhere to immobilized CXCL4 through alphavbeta3 integrin, and also through other integrins, such as alphavbeta5 and alpha5beta1
18632422 delayed pressure urticaria may be associated with increased secretion of platelet chemokines PF4 and beta-TG, similar to that observed in cold urticaria
18539895 PF4 or anti-PF4 antibody alone did not alter neutrophil function, costimulation with both reagents resulted in approximately 3-fold increase in neutrophil cell surface antigens
18369708 Literature analysis of commercial immunoassay results detecting platelet factor 4/heparin antibodies in healthy subjects.
18000592 possible roles of CXCL4 in monocyte arrest and macrophage foam cell formation in atherosclerosis
17998245 This study demonstrates that PF4 protein levels are a good indicator for the recovery of blood count in the complete remission of acute myeloid leukemia.
17914028 platelet-associated PF-4, but not its plasma counterpart, may represent a potential biomarker of early tumor presence
17827342 These findings indicate that the equilibrium between angiostatic and angiogenic factors during inflammation and tumor progression is rather complex and differs depending on the chemokine, cell type, and stimulus.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17700216 Patients with isolated coronary artery ectasia (CAE) have raised levels of plasma P-selectin, beta-TG and PF4 compared with control participants with angiographically normal coronary arteries, suggesting increased platelet activation in patients with CAE.
17675521 PF4-stimulated immediate monocyte functions (oxygen radical formation) are regulated by p38 MAPK, Syk, and PI3K, whereas delayed functions (survival and cytokine expression) are controlled by Erk and JNK.
17636189 a high titer of antibodies to PF4 but no relationship was found between that and heparin induced thrombocytopenia or thrombosis in this Turkish population.
17381065 Several PF4 fragments and modified molecules exhibit antiangiogenesis properties and may become an alternative for further therapeutic angiogenesis.
17265155 angiostatic non-ELR CXC chemokines may increase to balance angiogenic ELR+ CXC chemokines in which increased levels were shown in patients with inflammatory arthritides and CXCL4 may contribute to designate the chronicity of synovitis in patients with RA
17220270 CXCL4 decreased serum levels in advanced MDS, suggesting the possibility of a concerted disturbance of transcription or translation of these chemokines in advanced MDS
17218382 CXCL4 and CXCL4L1 exhibit a distinct subcellular localization and are secreted in a differentially regulated manner, suggesting distinct roles in inflammatory or homeostatic processes.
17090548 CXCL4 seals blood clots by altering the structure of fibrin
17077331 a candidate tumor suppressor gene, platelet factor 4, was frequently silenced by promoter hypermethylation in MM (15 of 28) and MM cell lines (5 of 5)
16881736 Salmonella could be used in vivo as a PF4 DNA delivery vector in the management of radiation injury
16317101 activated human skin mast cells (MCs) convert CTAP-III into biologically active NAP-2 through proteolytic cleavage by released chymase
16304054 cell-surface PF4 complexes are antigenic only over a restricted concentration range of PF4. Heparin is not required for HIT antibody binding but shifts the concentration of PF4 needed for optimal surface antigenicity to higher levels
15994292 PTEN expression negatively regulates CXCR4-meidated chemotaxis of lymphoid mammalian cells via its lipid phosphatase activity
15964840 analysis of granule targeting sequence within platelet factor 4
15788441 Expression of PF4 is up-regulated at the mRNA and protein level by thrombin and mediated by proteinase-activated receptors (PARs), resulting in a 32- to 128-fold higher mRNA level and leading to an up-to-sixfold increase of the peptide concentration.
15728475 Human platelet factor 4 stimulates proliferation of naturally anergic human CD4+CD25+ T regulatory cells while inhibiting proliferation of CD4+CD25- T nonregulatory cells.
15622770 PF4 had an inhibitory activity on megakaryocytopoiesis in vitro and in vivo in mice.
15591119 Induction of E-selectin RNA in umbilical vein endothelial cells exposed to PF4 is time and dose dependent; PF4 induces E-selectin expression by activation of transcriptional activity
15459010 Interactions with PF4 require structural motifs important in RANTES oligomerization and amplify RANTES-triggered effects on monocyte adhesion.
15304392 The capacity of PF4 to form ultralarge complexes composed of multiple PF4 tetramers arrayed in a lattice with several molecules of unfractionated heparin may play a fundamental role in autoantibody formation, antibody-dependent platelet activation.
15291808 PF-4 strongly inhibited the VEGF(165)- and VEGF(121)-induced mitogen-activated protein (MAP) kinase signalling pathways
15265941 PF-4 acts on macrophages in a dual manner. PF-4 may play a crucial role in the induction and maintenance of an unspecific immune response.
15187018 PF4 promoters are transactivated by USF1 and 2 which may play an important role in megakaryocytic gene expression
15034805 Review: PF-4 isinteracts directly with angiogenesis growth factors and inhibits their interaction with cell surface receptors, perhaps playing a role as an endogenous angiogenesis regulator; role in cancer pathology
14652645 correlation between PF4 deposition, lesion severity and symptomatic atherosclerosis; PF4 was commonly found in macrophages of early lesions
14592823 PF4 neutrophil adhesion is controlled by src-kinases and PF-4-mediated exocytosis requires activation of p38 MAP kinase and phosphatidylinositol 3-kinase
14575696 results suggested a model by which PF4 bound to proximal (but distinct) sites to antithrombin (AT) resulting in steric interference of factor Xa binding to both polysaccharide and AT
12878486 Gene profiling identified PF4 from peripheral blood cells in coronary artery disease.
12732210 PREP1 regulates PF4 gene expression.
12609838 physiologically relevant concentrations of PF4 stimulate thrombin-dependent activated protein C generation in cultured vascular endothelial cells
12586630 PF4 may modulate the hematopoietic milieu both by promoting progenitor adhesion and by binding to or interfering with signaling caused by hematopoietically active chemokines, such as IL-8
12384403 Platelet factor 4 inhibits FGF2-induced endothelial cell proliferation via the extracellular signal-regulated kinase pathway but not by the phosphatidylinositol 3-kinase pathway.
12223528 Platelet factor 4 induces human natural killer cells to synthesize and release interleukin-8.
12193731 CXCL4 at substimulatory dosages modulates CTAP-III- as well as CXCL7-induced adhesion of neutrophils to vascular endothelium.
12097379 PF4 inhibits T cell function by down-modulating cell proliferation and cytokine release and therefore has a potential role as a mediator of long-term effects in the regulation of inflammatory processes in vivo.
12041672 Signaling transduction induced by PF4 in erythroleukemia cells was compared with that induced by TGFB1, which is also a potent inhibitor of HEL growth.
11830470 a second epitope for heparin-induced thrombocytopenia/thrombosis antibodies is defined by epitope mapping

AA Sequence

MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTA      1 - 70
QLIATLKNGRKICLDLQAPLYKKIIKKLLES                                            71 - 101
//

Text Mined References (161)

PMID Year Title
26810286 2016 Expression of CXCL4 and aquaporin 3 and 10 mRNAs in patients with otitis media with effusion.
26524462 2015 CXCL4 Plasma Levels Are Not Associated with the Extent of Coronary Artery Disease or with Coronary Plaque Morphology.
26291604 2015 Distinguishing between anti-platelet factor 4/heparin antibodies that can and cannot cause heparin-induced thrombocytopenia.
26256688 2015 Intramedullary megakaryocytes internalize released platelet factor 4 and store it in alpha granules.
26225544 2015 Polyphosphates form antigenic complexes with platelet factor 4 (PF4) and enhance PF4-binding to bacteria.
26142741 2016 Low levels of circulating platelet factor 4 (PF4, CXCL4) in subclinically hypothyroid autoimmune thyroiditis.
25960020 2015 Heparin enhances uptake of platelet factor 4/heparin complexes by monocytes and macrophages.
25858640 2016 Expression of chemokines CXCL4 and CXCL7 by synovial macrophages defines an early stage of rheumatoid arthritis.
25604035 2015 Complexes of platelet factor 4 and heparin activate Toll-like receptor 4.
25342714 2015 Heparin-independent, PF4-dependent binding of HIT antibodies to platelets: implications for HIT pathogenesis.
25159325 2014 Growth factors/chemokines in diabetic vitreous and aqueous alter the function of bone marrow-derived progenitor (CD34?) cells in humans.
25150299 2014 Binding of anti-platelet factor 4/heparin antibodies depends on the thermodynamics of conformational changes in platelet factor 4.
24665827 2014 Inhibition of platelet activation could decrease thrombotic events in hemodialysis PF4/H antibody-positive patients.
24534089 2014 Role of the CXCL12-CXCR4 axis in the development of deep rectal endometriosis.
24469069 2014 CXCL4L1 and CXCL4 signaling in human lymphatic and microvascular endothelial cells and activated lymphocytes: involvement of mitogen-activated protein (MAP) kinases, Src and p70S6 kinase.
24177324 2014 Modulation of protein C activation by histones, platelet factor 4, and heparinoids: new insights into activated protein C formation.
24097975 2013 Distinct specificity and single-molecule kinetics characterize the interaction of pathogenic and non-pathogenic antibodies against platelet factor 4-heparin complexes with platelet factor 4.
24023389 2013 Vascular endothelial growth factor (VEGF) and platelet (PF-4) factor 4 inputs modulate human microvascular endothelial signaling in a three-dimensional matrix migration context.
23848403 2013 RUNX1, but not its familial platelet disorder mutants, synergistically activates PF4 gene expression in combination with ETS family proteins.
23769097 2013 Platelet factor 4-positive thrombi adhering to the ventricles of a ventricular assist device in patients with heparin-induced thrombocytopenia type II.
23710276 2013 New insights into the protective power of platelets in malaria infection.
23701307 2014 Altered angiogenesis in low birth weight individuals: a role for anti-angiogenic circulating factors.
23634812 2013 Platelet activation suppresses HIV-1 infection of T cells.
23621699 2013 Impact of polymorphisms affecting the ACP1 gene on levels of antibodies against platelet factor 4-heparin complexes.
23611535 2013 Persistence of subsyndromal residual symptoms after remission of major depression in patients without cardiovascular disease may condition maintenance of elevated platelet factor 4 and ?-thromboglobulin plasma levels.
23536183 2013 Alternative C-terminal helix orientation alters chemokine function: structure of the anti-angiogenic chemokine, CXCL4L1.
23352833 2013 Autocrine CCL2, CXCL4, CXCL9 and CXCL10 signal in retinal endothelial cells and are enhanced in diabetic retinopathy.
23268231 2013 Host response: PF4 - platelets' poison.
23245326 2012 Platelet factor 4 activity against P. falciparum and its translation to nonpeptidic mimics as antimalarials.
23224555 2012 Platelet factor 4 and Duffy antigen required for platelet killing of Plasmodium falciparum.
23216710 2013 Anti-PF4/heparin antibodies and venous graft occlusion in postcoronary artery bypass surgery patients randomized to postoperative unfractionated heparin or fondaparinux thromboprophylaxis.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22763266 2012 Genetic variants in platelet factor 4 modulate inflammatory and platelet activation biomarkers.
22740477 2012 Proteomic analysis reveals platelet factor 4 and beta-thromboglobulin as prognostic markers in severe acute respiratory syndrome.
22682144 2012 CXCL4-platelet factor 4, heparin-induced thrombocytopenia and cancer.
22645343 2012 Identification of the platelet-derived chemokine CXCL4/PF-4 as a broad-spectrum HIV-1 inhibitor.
22577175 2012 Dynamic antibody-binding properties in the pathogenesis of HIT.
22555803 2012 Impaired CXCL4 expression in tumor-associated macrophages (TAMs) of ovarian cancers arising in endometriosis.
22402885 2012 VEGF, PF4 and PDGF are elevated in platelets of colorectal cancer patients.
22318669 2012 Disruption of PF4/H multimolecular complex formation with a minimally anticoagulant heparin (ODSH).
22235911 2012 Binding of heparin-dependent antibodies to PF4 modified by enoxaparin oligosaccharides: evaluation by surface plasmon resonance and serotonin release assay.
22088491 2012 Clinical evaluation of acute systemic reaction and detection of IgG antibodies against PF4/heparin complexes in hemodialysis patients.
21931859 2011 Multiple ETS family proteins regulate PF4 gene expression by binding to the same ETS binding site.
21693026 2011 Platelet factor-4 and its p17-70 peptide inhibit myeloma proliferation and angiogenesis in vivo.
21508508 2011 CXCL4 and CXCL10 predict risk of fatal cerebral malaria.
21129147 2011 Mechanism of platelet factor 4 (PF4) deficiency with RUNX1 haplodeficiency: RUNX1 is a transcriptional regulator of PF4.
21111666 2011 The role of the CXC chemokines platelet factor-4 (CXCL4/PF-4) and its variant (CXCL4L1/PF-4var) in inflammation, angiogenesis and cancer.
21088050 2012 CXC chemokine ligand 4 (CXCL4) down-regulates CC chemokine receptor expression on human monocytes.
21041299 2011 Platelet factor 4 inhibits thrombomodulin-dependent activation of thrombin-activatable fibrinolysis inhibitor (TAFI) by thrombin.
20979952 2010 Prevalence of the antiheparin-platelet factor 4 antibody in hemodialysis (HD) patients and its effects upon dialysis access.
20961394 2011 CXCL4L1 inhibits angiogenesis and induces undirected endothelial cell migration without affecting endothelial cell proliferation and monocyte recruitment.
20688960 2010 Functional divergence between 2 chemokines is conferred by single amino acid change.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20626620 2010 Heparin-induced thrombocytopenia: towards standardization of platelet factor 4/heparin antigen tests.
20539902 2010 Evaluation of a new automated panel of assays for the detection of anti-PF4/heparin antibodies in patients suspected of having heparin-induced thrombocytopenia.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20185595 2010 Antibodies to platelet factor 4-heparin complex and outcome in hemodialysis patients with diabetes.
20182908 2010 Differential changes in platelet VEGF, Tsp, CXCL12, and CXCL4 in patients with metastatic cancer.
20104488 2010 CXCL4-induced monocyte survival, cytokine expression, and oxygen radical formation is regulated by sphingosine kinase 1.
20050998 2010 Anti-PF4/heparin antibody formation postorthopedic surgery thromboprophylaxis: the role of non-drug risk factors and evidence for a stoichiometry-based model of immunization.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19911252 2010 Heparin-platelet factor 4 antibodies in intensive care patients: an observational seroprevalence study.
19910578 2010 CXCL4 downregulates the atheroprotective hemoglobin receptor CD163 in human macrophages.
19805618 2010 {beta}2 Glycoprotein I ({beta}2GPI) binds platelet factor 4 (PF4): implications for the pathogenesis of antiphospholipid syndrome.
19773294 2009 Platelet factor 4 (CXCL4) facilitates human macrophage infection with HIV-1 and potentiates virus replication.
19750196 Platelet factor 4 is highly upregulated in dendritic cells after severe trauma.
19625657 2009 The cathelicidin LL-37 activates human mast cells and is degraded by mast cell tryptase: counter-regulation by CXCL4.
19470732 2009 Serum peptidome profiling revealed platelet factor 4 as a potential discriminating Peptide associated with pancreatic cancer.
19416867 2009 The transcriptome of human CD34+ hematopoietic stem-progenitor cells.
19397833 2009 Clinical relevance of heparin-PF4 complex antibody in DVT after total joint replacement.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19245795 2009 New insights into the molecular interaction of the C-terminal sequence of CXCL4 with fibroblast growth factor-2.
19201759 2009 Mediators of neutrophil recruitment in human abdominal aortic aneurysms.
18797178 2008 Elevated platelet activation in patients with atopic dermatitis and psoriasis: increased plasma levels of beta-thromboglobulin and platelet factor 4.
18648521 2008 The CXC-chemokine CXCL4 interacts with integrins implicated in angiogenesis.
18632422 2008 Increased concentration of platelet-derived chemokines in serum of patients with delayed pressure urticaria.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18539895 2008 Immune complexes formed following the binding of anti-platelet factor 4 (CXCL4) antibodies to CXCL4 stimulate human neutrophil activation and cell adhesion.
18369708 2008 Platelet factor 4/heparin antibody (IgG/M/A) in healthy subjects: a literature analysis of commercial immunoassay results.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18000592 2007 CXCL4 in atherosclerosis: possible roles in monocyte arrest and macrophage foam cell formation.
17998245 2008 Platelet factor-4 is an indicator of blood count recovery in acute myeloid leukemia patients in complete remission.
17914028 2008 Platelet-associated PF-4 as a biomarker of early tumor growth.
17827342 2007 Stimulation of angiostatic platelet factor-4 variant (CXCL4L1/PF-4var) versus inhibition of angiogenic granulocyte chemotactic protein-2 (CXCL6/GCP-2) in normal and tumoral mesenchymal cells.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17700216 2007 Increased platelet activity in patients with isolated coronary artery ectasia.
17675521 2007 Platelet factor 4 (CXC chemokine ligand 4) differentially regulates respiratory burst, survival, and cytokine expression of human monocytes by using distinct signaling pathways.
17636189 2007 Incidence of antiheparin-platelet factor 4 antibodies and heparin-induced thrombocytopenia in Turkish patients undergoing cardiac surgery.
17381065 2006 Roles of platelet factor 4 in hematopoiesis and angiogenesis.
17265155 2007 Synovial angiostatic non-ELR CXC chemokines in inflammatory arthritides: does CXCL4 designate chronicity of synovitis?
17244792 2007 Induction of dendritic cell-like phenotype in macrophages during foam cell formation.
17220270 2007 Serum proteome profiling detects myelodysplastic syndromes and identifies CXC chemokine ligands 4 and 7 as markers for advanced disease.
17218382 2007 PF-4/CXCL4 and CXCL4L1 exhibit distinct subcellular localization and a differentially regulated mechanism of secretion.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
17090548 2007 Platelet factor 4 (CXCL4) seals blood clots by altering the structure of fibrin.
17077331 2007 4q loss is potentially an important genetic event in MM tumorigenesis: identification of a tumor suppressor gene regulated by promoter methylation at 4q13.3, platelet factor 4.
16881736 2006 Live attenuated Salmonella carrying platelet factor 4 cDNAs as radioprotectors.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16317101 2006 Mast cells and neutrophils proteolytically activate chemokine precursor CTAP-III and are subject to counterregulation by PF-4 through inhibition of chymase and cathepsin G.
16304054 2006 Role of platelet surface PF4 antigenic complexes in heparin-induced thrombocytopenia pathogenesis: diagnostic and therapeutic implications.
15994292 2005 Negative regulation of CXCR4-mediated chemotaxis by the lipid phosphatase activity of tumor suppressor PTEN.
15964840 2005 Evidence for a granule targeting sequence within platelet factor 4.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15788441 2005 Regulated expression of platelet factor 4 in human monocytes--role of PARs as a quantitatively important monocyte activation pathway.
15728475 2005 Platelet factor 4 differentially modulates CD4+CD25+ (regulatory) versus CD4+CD25- (nonregulatory) T cells.
15622770 1997 [Bioassay of recombinant human platelet factor 4].
15591119 2005 Endothelial expression of E-selectin is induced by the platelet-specific chemokine platelet factor 4 through LRP in an NF-kappaB-dependent manner.
15531763 2005 Platelet factor 4 and interleukin-8 CXC chemokine heterodimer formation modulates function at the quaternary structural level.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459010 2005 Heterophilic interactions of platelet factor 4 and RANTES promote monocyte arrest on endothelium.
15304392 2005 Ultralarge complexes of PF4 and heparin are central to the pathogenesis of heparin-induced thrombocytopenia.
15291808 2004 Platelet factor 4 disrupts the intracellular signalling cascade induced by vascular endothelial growth factor by both KDR dependent and independent mechanisms.
15265941 2004 Platelet factor 4/CXCL4 induces phagocytosis and the generation of reactive oxygen metabolites in mononuclear phagocytes independently of Gi protein activation or intracellular calcium transients.
15187018 2004 Upstream stimulatory factors stimulate transcription through E-box motifs in the PF4 gene in megakaryocytes.
15034805 2004 The control of angiogenesis and tumor invasion by platelet factor-4 and platelet factor-4-derived molecules.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14652645 2003 Platelet factor 4 localization in carotid atherosclerotic plaques: correlation with clinical parameters.
14592823 2004 Platelet factor 4 (PF-4)-induced neutrophil adhesion is controlled by src-kinases, whereas PF-4-mediated exocytosis requires the additional activation of p38 MAP kinase and phosphatidylinositol 3-kinase.
14575696 2003 Platelet factor 4 neutralizes heparan sulfate-enhanced antithrombin inactivation of factor Xa by preventing interaction(s) of enzyme with polysaccharide.
12878486 2003 Gene profiling identifies secreted protein transcripts from peripheral blood cells in coronary artery disease.
12782716 2003 An alternatively spliced variant of CXCR3 mediates the inhibition of endothelial cell growth induced by IP-10, Mig, and I-TAC, and acts as functional receptor for platelet factor 4.
12732210 2003 PREP1, MEIS1 homolog protein, regulates PF4 gene expression.
12609838 2003 Platelet factor 4 enhances generation of activated protein C in vitro and in vivo.
12586630 2003 Platelet factor 4 promotes adhesion of hematopoietic progenitor cells and binds IL-8: novel mechanisms for modulation of hematopoiesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12466273 2003 Platelet factor 4 enhances the binding of oxidized low-density lipoprotein to vascular wall cells.
12384403 2002 Platelet factor 4 inhibits FGF2-induced endothelial cell proliferation via the extracellular signal-regulated kinase pathway but not by the phosphatidylinositol 3-kinase pathway.
12223528 2002 Platelet factor 4 induces human natural killer cells to synthesize and release interleukin-8.
12193731 2002 Platelet-derived chemokines CXC chemokine ligand (CXCL)7, connective tissue-activating peptide III, and CXCL4 differentially affect and cross-regulate neutrophil adhesion and transendothelial migration.
12097379 2002 Platelet factor 4 inhibits proliferation and cytokine release of activated human T cells.
12041672 2002 Signal transduction of chemokine platelet factor 4 in human erythroleukemia cells.
11986215 2002 Platelet factor 4 binds to low-density lipoprotein receptors and disrupts the endocytic machinery, resulting in retention of low-density lipoprotein on the cell surface.
11685038 2001 The role of platelet factor 4 in platelet aggregation induced by the antibodies implicated in heparin-induced thrombocytopenia.
11468158 2001 Localization of distal regulatory domains in the megakaryocyte-specific platelet basic protein/platelet factor 4 gene locus.
10666185 2000 The CXC-chemokine platelet factor 4 promotes monocyte survival and induces monocyte differentiation into macrophages.
10464257 1999 Heparin dodecasaccharide binding to platelet factor-4 and growth-related protein-alpha. Induction of a partially folded state and implications for heparin-induced thrombocytopenia.
9558385 1998 Platelet factor 4 modulates fibroblast growth factor 2 (FGF-2) activity and inhibits FGF-2 dimerization.
9531587 1998 New insights into the negative regulation of hematopoiesis by chemokine platelet factor 4 and related peptides.
9395524 1997 Platelet factor 4 binds to glycanated forms of thrombomodulin and to protein C. A potential mechanism for enhancing generation of activated protein C.
8613703 1996 Serglycin-binding proteins in activated macrophages and platelets.
8511754 1993 The effect of secreted heparin-binding proteins on heparin binding to platelets.
8031770 1994 Crystal structure of recombinant human platelet factor 4.
7835432 1995 Quarternary structure amplification of protein folding differences observed in 'native' platelet factor-4.
7644496 1995 A potent inhibitor of endothelial cell proliferation is generated by proteolytic cleavage of the chemokine platelet factor 4.
7547867 1995 NMR solution structure of the 32-kDa platelet factor 4 ELR-motif N-terminal chimera: a symmetric tetramer.
7524669 1994 Histidine-rich glycoprotein and platelet factor 4 mask heparan sulfate proteoglycans recognized by acidic and basic fibroblast growth factor.
6945600 1981 Platelet factor 4 is chemotactic for neutrophils and monocytes.
6445090 1980 Complete covalent structure of human platelet factor 4.
6187750 1983 Chemotactic activity of platelet alpha granule proteins for fibroblasts.
5789664 1969 Platelet factor 4 and adenosine diphosphate release during human platelet aggregation.
3622011 1987 Human platelet factor 4 gene is mapped to 4q12----q21.
3098319 1987 Cloning and characterization of platelet factor 4 cDNA derived from a human erythroleukemic cell line.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.
2140694 1990 Negative regulation of human megakaryocytopoiesis by human platelet factor 4 and beta thromboglobulin: comparative analysis in bone marrow cultures from normal individuals and patients with essential thrombocythaemia and immune thrombocytopenic purpura.
1695112 1990 Structural and functional comparison of the genes for human platelet factor 4 and PF4alt.
1688470 1990 Inhibition of angiogenesis by recombinant human platelet factor-4 and related peptides.
893407 1977 Isolation, crystallization, and primary amino acid sequence of human platelet factor 4.
803847 1975 Antigenic and antiheparin properties of human platelet factor 4 (PF4).
601757 1977 Primary structure of human platelet factor 4.
267922 1977 Amino acid sequence of human platelet factor 4.