Property Summary

NCBI Gene PubMed Count 24
PubMed Score 10.00
PubTator Score 9.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.200 1.2e-03
ependymoma -1.200 2.5e-03
osteosarcoma -1.891 7.7e-07
lung cancer 1.700 2.3e-04
ulcerative colitis -1.400 5.4e-06
ovarian cancer 1.300 6.9e-07

Gene RIF (8)

PMID Text
26627908 In yeast, PEX26 follows the pathway that also ensures correct targeting of Pex15: PEX26 enters the endoplasmic reticulum (ER) in a GET-dependent and Pex19-independent manner.
25016021 results suggested that peroxisome biogenesis requires Pex1p- and Pex6p-regulated dissociation of Pex14p from Pex26p
23460677 PEX19 formed a complex with the peroxisomal tail anchored protein PEX26 in the cytosol and translocated it directly to peroxisomes by a TRC40-independent class I pathway.
19105186 the relative fraction of disease-causing alleles that occur in the coding and splice junction sequences of PEX26 gene.
16763195 We analyzed targeting of human PEX26. Its C-terminal-targeting signal contains two binding sites for PEX19 and we conclude C-terminal PEX19-binding sites mark tail-anchored proteins for delivery to peroxisomes.
16257970 Pex26p functions in recruiting to peroxisomes the complexes of the AAA ATPase peroxins.
15858711 PEX26 deficiency impairs peroxisomal import of both PTS1- and PTS2-targeted matrix proteins. It undergoes alternative splicing to produce several splice forms, including PEX26-delta, which rescues peroxisome biogenesis in PEX26-deficient cells.
12851857 degree of temperature sensitivity in pex26 cell lines is predictive of the clinical phenotype in patients with PEX26 deficiency

AA Sequence

MKSDSSTSAAPLRGLGGPLRSSEPVRAVPARAPAVDLLEEAADLLVVHLDFRAALETCERAWQSLANHAV      1 - 70
AEEPAGTSLEVKCSLCVVGIQALAEMDRWQEVLSWVLQYYQVPEKLPPKVLELCILLYSKMQEPGAVLDV     71 - 140
VGAWLQDPANQNLPEYGALAEFHVQRVLLPLGCLSEAEELVVGSAAFGEERRLDVLQAIHTARQQQKQEH    141 - 210
SGSEEAQKPNLEGSVSHKFLSLPMLVRQLWDSAVSHFFSLPFKKSLLAALILCLLVVRFDPASPSSLHFL    211 - 280
YKLAQLFRWIRKAAFSRLYQLRIRD                                                 281 - 305
//

Text Mined References (25)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26627908 2015 Conserved targeting information in mammalian and fungal peroxisomal tail-anchored proteins.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25016021 2014 AAA peroxins and their recruiter Pex26p modulate the interactions of peroxins involved in peroxisomal protein import.
23460677 2013 Tail-anchored PEX26 targets peroxisomes via a PEX19-dependent and TRC40-independent class I pathway.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20531392 2010 The peroxisomal receptor Pex19p forms a helical mPTS recognition domain.
19105186 2009 Identification of novel mutations and sequence variation in the Zellweger syndrome spectrum of peroxisome biogenesis disorders.
16854980 2006 Dynamic and functional assembly of the AAA peroxins, Pex1p and Pex6p, and their membrane receptor Pex26p.
16763195 2006 Targeting of the tail-anchored peroxisomal membrane proteins PEX26 and PEX15 occurs through C-terminal PEX19-binding sites.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16257970 2006 Mutations in the peroxin Pex26p responsible for peroxisome biogenesis disorders of complementation group 8 impair its stability, peroxisomal localization, and interaction with the Pex1p x Pex6p complex.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15858711 2005 Alternative splicing suggests extended function of PEX26 in peroxisome biogenesis.
15713480 2005 Analysis of human Pex19p's domain structure by pentapeptide scanning mutagenesis.
15542397 2004 The PEX Gene Screen: molecular diagnosis of peroxisome biogenesis disorders in the Zellweger syndrome spectrum.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12851857 2003 Mutations in novel peroxin gene PEX26 that cause peroxisome-biogenesis disorders of complementation group 8 provide a genotype-phenotype correlation.
12717447 2003 The pathogenic peroxin Pex26p recruits the Pex1p-Pex6p AAA ATPase complexes to peroxisomes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10591208 1999 The DNA sequence of human chromosome 22.