Property Summary

NCBI Gene PubMed Count 27
PubMed Score 25.57
PubTator Score 21.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma -1.100 1.5e-05

 GO Function (1)

Gene RIF (6)

PMID Text
25002403 PEX16 mediates the peroxisomal trafficking of two distinct peroxisomal membrane proteins, PEX3 and PMP34, via the endoplasmic reticulum
21768384 Data show that knockdown of Sec16B but not Sec16A by RNAi affected the morphology of peroxisomes, inhibited the transport of Pex16 from the ER to peroxisomes, and suppressed expression of Pex3.
20647552 An unusual variant peroxisome biogenesis disorder caused by mutations in the PEX16 gene, with a relatively mild clinical phenotype and an unexpected phenotype in fibroblasts, was identified.
16717127 PEX16 regulates peroxisome assembly by being cotranslationally inserted into the ER and serving to recruit other peroxisomal membrane proteins to membranes.
12223482 Pex16p functions in peroxisome membrane assembly, more likely upstream of Pex3p
11890679 aberrant splicing mutation of the PEX16 gene in patients with Zellweger syndrome

AA Sequence

MEKLRLLGLRYQEYVTRHPAATAQLETAVRGFSYLLAGRFADSHELSELVYSASNLLVLLNDGILRKELR      1 - 70
KKLPVSLSQQKLLTWLSVLECVEVFMEMGAAKVWGEVGRWLVIALVQLAKAVLRMLLLLWFKAGLQTSPP     71 - 140
IVPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRVVRTLQNTPSLHSRHWGAPQQREGRQQQHHEELSATP    141 - 210
TPLGLQETIAEFLYIARPLLHLLSLGLWGQRSWKPWLLAGVVDVTSLSLLSDRKGLTRRERRELRRRTIL    211 - 280
LLYYLLRSPFYDRFSEARILFLLQLLADHVPGVGLVTRPLMDYLPTWQKIYFYSWG                  281 - 336
//

Text Mined References (28)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25002403 2014 PEX16 contributes to peroxisome maintenance by constantly trafficking PEX3 via the ER.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21768384 2011 Sec16B is involved in the endoplasmic reticulum export of the peroxisomal membrane biogenesis factor peroxin 16 (Pex16) in mammalian cells.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
20647552 2010 Identification of an unusual variant peroxisome biogenesis disorder caused by mutations in the PEX16 gene.
20531392 2010 The peroxisomal receptor Pex19p forms a helical mPTS recognition domain.
19946888 2010 Defining the membrane proteome of NK cells.
19479899 2009 Pex3p-dependent peroxisomal biogenesis initiates in the endoplasmic reticulum of human fibroblasts.
19114594 2008 The peroxisomal membrane protein import receptor Pex3p is directly transported to peroxisomes by a novel Pex19p- and Pex16p-dependent pathway.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16717127 2006 The origin and maintenance of mammalian peroxisomes involves a de novo PEX16-dependent pathway from the ER.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16341674 2005 Transcriptome analysis of human gastric cancer.
15813749 2005 Requirement for microtubules and dynein motors in the earliest stages of peroxisome biogenesis.
15713480 2005 Analysis of human Pex19p's domain structure by pentapeptide scanning mutagenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14709540 2004 PEX19 is a predominantly cytosolic chaperone and import receptor for class 1 peroxisomal membrane proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12223482 2002 The membrane biogenesis peroxin Pex16p. Topogenesis and functional roles in peroxisomal membrane assembly.
12096124 2002 Analysis of mammalian peroxin interactions using a non-transcription-based bacterial two-hybrid assay.
11390669 2001 Human pex19p binds peroxisomal integral membrane proteins at regions distinct from their sorting sequences.
10704444 2000 PEX19 binds multiple peroxisomal membrane proteins, is predominantly cytoplasmic, and is required for peroxisome membrane synthesis.
9922452 1999 Peroxisome synthesis in the absence of preexisting peroxisomes.
9837814 1998 Mutation in PEX16 is causal in the peroxisome-deficient Zellweger syndrome of complementation group D.