Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.99
PubTator Score 2.10

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MASLSGLASALESYRGRDRLIRVLGYCCQLVGGVLVEQCPARSEVGTRLLVVSTQLSHCRTILRLFDDLA      1 - 70
MFVYTKQYGLGAQEEDAFVRCVSVLGNLADQLYYPCEHVAWAADARVLHVDSSRWWTLSTTLWALSLLLG     71 - 140
VARSLWMLLKLRQRLRSPTAPFTSPLPRGKRRAMEAQMQSEALSLLSNLADLANAVHWLPRGVLWAGRFP    141 - 210
PWLVGLMGTISSILSMYQAARAGGQAEATTP                                           211 - 241
//

Text Mined References (7)

PMID Year Title