Property Summary

NCBI Gene PubMed Count 24
PubMed Score 10.19
PubTator Score 11.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (6)

PMID Text
23308220 Self-interaction of human Pex11beta during peroxisomal growth and division regulates its membrane deforming activity in conjunction with membrane lipids.
22581969 A new study identifies the first patient with a mutation in PEX11beta.These new findings widen the spectrum of clinical and cellular phenotypes of peroxisome biogenesis disorders.
22581968 Excluding mutations in all PEX genes previously implicated in peroxisome biogenesis disorders, it was found that the defect was caused by a homozygous non-sense mutation in the PEX11beta gene.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20826455 coordinates peroxisome membrane proliferation and maintenance
17408615 Fis1 plays important roles in peroxisome division and maintenance of peroxisome morphology in mammalian cells, possibly in a concerted manner with Pex11pbeta and DLP1.

AA Sequence

MDAWVRFSAQSQARERLCRAAQYACSLLGHALQRHGASPELQKQIRQLESHLSLGRKLLRLGNSADALES      1 - 70
AKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWAQRSFRYYLFSLIMNLSRDAY     71 - 140
EIRLLMEQESSACSRRLKGSGGGVPGGSETGGLGGPGTPGGGLPQLALKLRLQVLLLARVLRGHPPLLLD    141 - 210
VVRNACDLFIPLDKLGLWRCGPGIVGLCGLVSSILSILTLIYPWLRLKP                         211 - 259
//

Text Mined References (28)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23308220 2013 Self-interaction of human Pex11p? during peroxisomal growth and division.
22581969 2012 First PEX11? patient extends spectrum of peroxisomal biogenesis disorder phenotypes.
22581968 2012 A novel defect of peroxisome division due to a homozygous non-sense mutation in the PEX11? gene.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20826455 2010 PEX11 family members are membrane elongation factors that coordinate peroxisome proliferation and maintenance.
20531392 2010 The peroxisomal receptor Pex19p forms a helical mPTS recognition domain.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19229552 2009 Peroxisomes in airway epithelia and future prospects of these organelles for pulmonary cell biology.
18782765 2008 Targeting of hFis1 to peroxisomes is mediated by Pex19p.
17408615 2007 Fis1, DLP1, and Pex11p coordinately regulate peroxisome morphogenesis.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14709540 2004 PEX19 is a predominantly cytosolic chaperone and import receptor for class 1 peroxisomal membrane proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12618434 2003 The dynamin-like GTPase DLP1 is essential for peroxisome division and is recruited to peroxisomes in part by PEX11.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12096124 2002 Analysis of mammalian peroxin interactions using a non-transcription-based bacterial two-hybrid assay.
10704444 2000 PEX19 binds multiple peroxisomal membrane proteins, is predominantly cytoplasmic, and is required for peroxisome membrane synthesis.
9922452 1999 Peroxisome synthesis in the absence of preexisting peroxisomes.
9826565 1998 cDNA cloning and characterization of a constitutively expressed isoform of the human peroxin Pex11p.
9792670 1998 Expression of PEX11beta mediates peroxisome proliferation in the absence of extracellular stimuli.