Property Summary

NCBI Gene PubMed Count 105
PubMed Score 71.38
PubTator Score 1637.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma -1.031 3.7e-04
Breast cancer -2.200 3.7e-02
breast carcinoma -1.500 2.1e-05
colon cancer -1.100 2.1e-03
ductal carcinoma in situ -2.000 6.9e-04
ependymoma 1.100 2.3e-02
group 4 medulloblastoma -1.400 5.6e-07
hepatocellular carcinoma -1.500 3.3e-03
interstitial lung disease -1.400 4.5e-02
intraductal papillary-mucinous carcinoma... -1.200 1.9e-02
invasive ductal carcinoma -2.100 6.2e-04
lung adenocarcinoma -2.300 8.0e-13
lung cancer -1.400 8.5e-03
malignant mesothelioma 1.800 9.0e-07
non-small cell lung cancer -1.268 2.0e-11
psoriasis -1.200 1.4e-04
sarcoidosis -1.100 4.0e-02
urothelial carcinoma -1.100 4.2e-05

Protein-protein Interaction (4)

Gene RIF (84)

AA Sequence

MSGPLEGADGGGDPRPGESFCPGGVPSPGPPQHRPCPGPSLADDTDANSNGSSGNESNGHESRGASQRSS      1 - 70
HSSSSGNGKDSALLETTESSKSTNSQSPSPPSSSIAYSLLSASSEQDNPSTSGCSSEQSARARTQKELMT     71 - 140
ALRELKLRLPPERRGKGRSGTLATLQYALACVKQVQANQEYYQQWSLEEGEPCSMDMSTYTLEELEHITS    141 - 210
EYTLQNQDTFSVAVSFLTGRIVYISEQAAVLLRCKRDVFRGTRFSELLAPQDVGVFYGSTAPSRLPTWGT    211 - 280
GASAGSGLRDFTQEKSVFCRIRGGPDRDPGPRYQPFRLTPYVTKIRVSDGAPAQPCCLLIAERIHSGYEA    281 - 350
PRIPPDKRIFTTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPF    351 - 420
DHSPIRFCARNGEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPAPSPAPSLDTDIQELS    421 - 490
EQIHRLLLQPVHSPSPTGLCGVGAVTSPGPLHSPGSSSDSNGGDAEGPGPPAPVTFQQICKDVHLVKHQG    491 - 560
QQLFIESRARPQSRPRLPATGTFKAKALPCQSPDPELEAGSAPVQAPLALVPEEAERKEASSCSYQQINC    561 - 630
LDSILRYLESCNLPSTTKRKCASSSSYTTSSASDDDRQRTGPVSVGTKKDPPSAALSGEGATPRKEPVVG    631 - 700
GTLSPLALANKAESVVSVTSQCSFSSTIVHVGDKKPPESDIIMMEDLPGLAPGPAPSPAPSPTVAPDPAP    701 - 770
DAYRPVGLTKAVLSLHTQKEEQAFLSRFRDLGRLRGLDSSSTAPSALGERGCHHGPAPPSRRHHCRSKAK    771 - 840
RSRHHQNPRAEAPCYVSHPSPVPPSTPWPTPPATTPFPAVVQPYPLPVFSPRGGPQPLPPAPTSVPPAAF    841 - 910
PAPLVTPMVALVLPNYLFPTPSSYPYGALQTPAEGPPTPASHSPSPSLPALAPSPPHRPDSPLFNSRCSS    911 - 980
PLQLNLLQLEELPRAEGAAVAGGPGSSAGPPPPSAEAAEPEARLAEVTESSNQDALSGSSDLLELLLQED    981 - 1050
SRSGTGSAASGSLGSGLGSGSGSGSHEGGSTSASITRSSQSSHTSKYFGSIDSSEAEAGAARGGAEPGDQ   1051 - 1120
VIKYVLQDPIWLLMANADQRVMMTYQVPSRDMTSVLKQDRERLRAMQKQQPRFSEDQRRELGAVHSWVRK   1121 - 1190
GQLPRALDVMACVDCGSSTQDPGHPDDPLFSELDGLGLEPMEEGGGEQGSSGGGSGEGEGCEEAQGGAKA   1191 - 1260
SSSQDLAMEEEEEGRSSSSPALPTAGNCTS                                           1261 - 1290
//

Text Mined References (118)

PMID Year Title