Property Summary

NCBI Gene PubMed Count 82
PubMed Score 915.05
PubTator Score 444.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.300 3.5e-03
glioblastoma 1.100 3.1e-02
tuberculosis 1.500 2.2e-08
pancreatic ductal adenocarcinoma liver m... -2.162 5.1e-03
intraductal papillary-mucinous carcinoma... -1.600 8.7e-04
intraductal papillary-mucinous neoplasm ... -1.300 6.4e-03
diabetes mellitus -1.100 1.5e-03
ovarian cancer 1.400 1.6e-05

 OMIM Phenotype (1)

Gene RIF (52)

PMID Text
26509313 absence of prolidase activity in pterygium tissue indicates that there is no collagen turnover in this tissue
26159719 Prolidase was required for IFNAR1 maturation and accumulation, activation of IFNbeta-stimulated gene induction, and IFN-I-dependent viral control.
26087900 The association between the PEPD genetic variant and the risk of T2D was modulated by n-3 fatty acids. Higher n-3 fatty acids may abolish the adverse effect of the risk allele at PEPD for T2D
26078578 Levels of both serum prolidase and AFP could contribute to the early diagnosing of hepatocellular carcinoma.
25994092 Decreased serum prolidase activity may be associated with knee osteoarthritis
25842545 Serum prolidase level was significantly higher in schizophrenia patients compared to the controls.
25120796 There may be an ethnic- and/or sex-specific association of the PEPD rs731839 single nucleotide polymorphism and serum lipid levels in Mulao and Han populations
25031340 Prolidase is required for early trafficking events during influenza A virus entry.
24810047 Suggest prolidase as a high affinity ligand of the ErbB2 receptor which can regulate ErbB2 signaling and cell growth.
24612543 Significantly lower prolidase activity in patients with benign joint hypermobility syndrome suggests that prolidase may affect the collagen metabolism and cause hyperlaxity.
24484408 Serum C4b, FN, and PEPD are associated with the pathological changes of pulmonary tuberculosis.
24225260 High prolidase activity may indicate critical biological activities relevant to pathological events in Behcet's disease, and this activity may be a biological indicator of disease.
24065222 prolidase may share an undefined role in fibrosis in heart failure and may have a role in the diffuse fibrosis of heart failure.
23553128 Patients with psoriasis exhibit higher serum prolidase activity independent of gender, BMI, disease severity or duration, type of treatments or nitric oxide level.
23549681 Prolidase dependent HIF1A expression in breast cancer cells is induced by prolidase substrate peptides.
23516557 kinetic and structural evidences on human prolidase pathological mutants
23457135 A diminished prolidase activity may contribute to alteration of collagen metabolism and should be considered a biomarker of myeloproliferative neoplasms progress.
23287645 Although approximately 70 PEPD gene mutations and polymorphisms have been reported in various ethnic groups, we however report, for the first time, the identification of insertion mutation in human the PEPD gene.
23242638 Serum PEPD activity appears to be higher in patients with diabetic foot ulcers when compared with patients without diabetic foot ulcers and healthy controls.
23212918 PEPD is a ligand of EGFR and presents a novel mechanism of EGFR activation
23171426 Varicose venous wall prolidase enzyme activity could be an important factor in progression of azoospermia and infertility in patients with varicocele.
23163753 Data suggest that elevated serum prolidase activity and oxidative stress may be associated with increased cardiovascular risk in polycystic ovary syndrome (PCOS) and/or menstrual irregularities associated with this syndrome.
22999980 A Mn(II)-Mn(II) center in human prolidase.
22811354 Assessed the serum prolidase enzyme level and the oxidative-antioxidative status in chronic hepatitis C infection. The prolidase was higher in the chronic hepatitis C group compared to the control group.
22258852 Increased prolidase seems to be associated with increased NO levels and oxidative stress along with decreased antioxidant levels in bladder cancer.
22245250 Relinoic acid regulates prolidase activity in human dermal cells via IGF receptor signaling in photoaged cells.
22185542 elevated in submucosal uterine fibroids
21722016 Serum prolidase activity is elevated in patients with pulmonary tuberculosis
21304409 Prolidase activity was positively correlated erum prolidase activity is significantly associated with Legg-Calve-Perthes disease.
20868675 investigation of role of prolidase in regulation of expression of TGF beta1 & TGF beta1 receptor in skin fibroblasts: down-regulation by prolidase inhibitors (Cbz-Pro & PEP); up-regulation by prolidase products (Pro & HyPro)
20626024 found serum prolidase activity was significantly lower in both Idiopathic and ischemic dilated cardiomyopathies (DCM) groups relative to healthy volunteers and lower in ischemic DCM than idiopathic.
20486204 Serum prolidase activity seems to be correlated with the level of fibrosis in patients with non-alcoholic steatohepatitis.
20437180 In the early pregnancy loss group compared to the control group, serum levels of prolidase activity were significantly lower and placental tissue activity levels were significantly higher.
20383038 Data suggest that the presence of ascending aortic aneurysms is associated with low serum prolidase activity.
20087956 Data shows prolidase activity was significantly increased in patients with thalassemia major compared with controls.
19823062 Increased serum prolidase activity and oxidative stress may be associated with endometrial cancer, and increased serum prolidase activity may be related to local invasion of endometrial cancer.
19401414 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19263194 characterization of erythrocyte prolidase I and II; effect of sulfur-containing amino acids on activities of prolidase I & II isolated from erythrocytes of healthy individuals, & a patient with prolidase deficiency were investigated
18989777 Serum prolidase enzyme activity can accurately predict the degree and stage of all histological lesions in non-alcoholic fatty liver disease.
18607169 serum prolidase activity is significantly associated with the presence and severity of coronary artery disease, and elevated serum prolidase activity might be an independent predictor of coronary atherosclerosis.
18550075 The kinetics of prodilase enzymatic reaction was analyzed by capillary electrophoresis and electrochemiluminescence with simplicity and efficiency.
18514097 presence of atrial fibrillation in patients with severe mitral stenosis may be associated with the plasma prolidase activity, tissue and plasma oxidative parameters
18387361 Higher prolidase activities in pleural tuberculosis patients might reflect increased collagen turnover in those patients, since prolidase is involved in the final stage of degradation in collagen catabolism.
18202846 Serum levels of prolidase were lower in the choldren with joint hypermobility compared with controls; there was significant negative correlation between prolidase level and Beighton score
17999410 differential expression of prolidase in 2 breast cancer cell lines showed prolidase-dependent differences in HIF-1 alpha levels
17604013 Data show that serum prolidase activity is associated with the presence hypertension independent of left ventricular hypertrophy.
17570078 Prolidase deficiency and systemic lupus erythematosus share a number of common immunological features.
17377743 Prolidase is viable target for selective activation of melphalan prodrugs in melanoma cells.
17096092 oxidative stress and decreased prolidase activity may have a role in pathogenesis of knee osteoarthritis
16999949 Significant correlation was observed between serum prolidase activity, and total antioxidant capacity, total oxidant status and oxidative stress index (p<0.01, r=-0.367; p<0.05, r=0.283; p<0.01, r=0.379; respectively) in H. pylori-positive subjects.
15878628 Carbobenzoxyproline is a potent inhibitor of prolidase in cultured fibroblasts from patients with prolidase deficiency.
11820613 FAK-independent regulation of prolidase activity and collagen biosynthesis in MCF-7 cells.

AA Sequence

MAAATGPSFWLGNETLKVPLALFALNRQRLCERLRKNPAVQAGSIVVLQGGEETQRYCTDTGVLFRQESF      1 - 70
FHWAFGVTEPGCYGVIDVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEKYAVDDVQYVDEIASVLTSQK     71 - 140
PSVLLTLRGVNTDSGSVCREASFDGISKFEVNNTILHPEIVECRVFKTDMELEVLRYTNKISSEAHREVM    141 - 210
KAVKVGMKEYELESLFEHYCYSRGGMRHSSYTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGE    211 - 280
YYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEELAHMGILSGS    281 - 350
VDAMVQAHLGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDH    351 - 420
LLDEALADPARASFLNREVLQRFRGFGGVRIEEDVVVTDSGIELLTCVPRTVEEIEACMAGCDKAFTPFS    421 - 490
GPK                                                                       491 - 493
//

Text Mined References (86)

PMID Year Title
26509313 2015 Prolidase Enzyme Activity in Conjunctiva and Pterygium Tissues.
26159719 2015 Flavivirus Antagonism of Type I Interferon Signaling Reveals Prolidase as a Regulator of IFNAR1 Surface Expression.
26087900 2015 Modulation of the Association between the PEPD Variant and the Risk of Type 2 Diabetes by n-3 Fatty Acids in Chinese Hans.
26078578 2015 Assessment of the correlation between serum prolidase and alpha-fetoprotein levels in patients with hepatocellular carcinoma.
25994092 2015 Evaluation of prolidase activity and oxidative status in patients with knee osteoarthritis: relationships with radiographic severity and clinical parameters.
25842545 2015 Prolidase activity and oxidative stress in patients with schizophrenia: a preliminary study.
25120796 2014 Sex-specific association of the peptidase D gene rs731839 polymorphism and serum lipid levels in the Mulao and Han populations.
25031340 2014 Prolidase is required for early trafficking events during influenza A virus entry.
24810047 2014 Identification of prolidase as a high affinity ligand of the ErbB2 receptor and its regulation of ErbB2 signaling and cell growth.
24612543 2014 Serum prolidase activity in benign joint hypermobility syndrome.
24484408 2014 Serum complement C4b, fibronectin, and prolidase are associated with the pathological changes of pulmonary tuberculosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24225260 2014 Serum prolidase enzyme activity and oxidative status in patients with Behçet's disease.
24105470 2014 A meta-analysis of genome-wide association studies for adiponectin levels in East Asians identifies a novel locus near WDR11-FGFR2.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24065222 2013 Fibrosis in heart failure subtypes.
23553128 2013 Serum prolidase activity in psoriasis patients.
23549681 2013 The effect of estrogen on prolidase-dependent regulation of HIF-1? expression in breast cancer cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23516557 2013 Kinetic and structural evidences on human prolidase pathological mutants suggest strategies for enzyme functional rescue.
23457135 The decrease in prolidase activity in myeloproliferative neoplasms.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23287645 2013 Identification and analysis of a novel mutation in PEPD gene in two Kashmiri siblings with prolidase enzyme deficiency.
23242638 2013 Serum prolidase activity in diabetic foot ulcers.
23212918 2013 Prolidase directly binds and activates epidermal growth factor receptor and stimulates downstream signaling.
23171426 2013 Prolidase enzyme activity in varicose venous walls related to sperm count in patients with varicocele.
23163753 2013 Increased prolidase activity and oxidative stress in PCOS.
22999980 2013 A Mn(II)-Mn(II) center in human prolidase.
22811354 2012 Prolidase and oxidative stress in chronic hepatitis C.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22479202 2012 Novel loci for adiponectin levels and their influence on type 2 diabetes and metabolic traits: a multi-ethnic meta-analysis of 45,891 individuals.
22258852 2012 Serum prolidase activity, oxidative stress, and nitric oxide levels in patients with bladder cancer.
22245250 2012 The retinoic acid-induced up-regulation of insulin-like growth factor 1 and 2 is associated with prolidase-dependent collagen synthesis in UVA-irradiated human dermal equivalents.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22185542 2012 Oxidative stress and prolidase activity in women with uterine fibroids.
22158537 2011 Meta-analysis of genome-wide association studies identifies eight new loci for type 2 diabetes in east Asians.
21722016 2011 Serum prolidase activity in patients with pulmonary tuberculosis.
21304409 2011 Serum prolidase activity and oxidative-antioxidative status in Legg-Calve-Perthes disease.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20868675 2010 Prolidase-dependent regulation of TGF ? (corrected) and TGF ? receptor expressions in human skin fibroblasts.
20626024 2010 Serum prolidase activity in idiopathic and ischemic cardiomyopathy patients.
20486204 2010 Serum prolidase enzyme activity and its relation to histopathological findings in patients with non-alcoholic steatohepatitis.
20437180 2011 Comparison of prolidase enzyme activities of maternal serum and placental tissue in patients with early pregnancy failure.
20383038 2010 Dilatation of the ascending aorta is associated with low serum prolidase activity.
20087956 2010 Prolidase activity and oxidative status in patients with thalassemia major.
19823062 2009 Serum prolidase activity and oxidative status in patients with stage I endometrial cancer.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19401414 2009 Confirmation of multiple risk Loci and genetic impacts by a genome-wide association study of type 2 diabetes in the Japanese population.
19263194 2009 Characterization of prolidase I and II purified from normal human erythrocytes: comparison with prolidase in erythrocytes from a patient with prolidase deficiency.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18989777 2009 Diagnostic value of serum prolidase enzyme activity to predict the liver histological lesions in non-alcoholic fatty liver disease: a surrogate marker to distinguish steatohepatitis from simple steatosis.
18607169 2008 The association of serum prolidase activity with the presence and severity of coronary artery disease.
18550075 2008 Kinetic study of prolidase activity in erythrocytes against different substrates using capillary electrophoresis with electrochemiluminescence detection.
18514097 2008 Association of prolidase activity, oxidative parameters, and presence of atrial fibrillation in patients with mitral stenosis.
18387361 2008 Prolidase activity in serum and pleural fluids in patients with tuberculous pleural effusion [correction of effussion].
18202846 2008 Is joint hypermobility important in prepubertal children?
17999410 2008 Extracellular matrix and HIF-1 signaling: the role of prolidase.
17604013 2007 Serum prolidase activity in patients with hypertension and its relation with left ventricular hypertrophy.
17570078 2007 Systemic lupus erythematosus-like disease in a 6-year-old boy with prolidase deficiency.
17377743 2007 Proline prodrug of melphalan targeted to prolidase, a prodrug activating enzyme overexpressed in melanoma.
17142620 2006 Molecular characterisation of six patients with prolidase deficiency: identification of the first small duplication in the prolidase gene and of a mutation generating symptomatic and asymptomatic outcomes within the same family.
17096092 2007 Increased oxidative stress and its relation with collagen metabolism in knee osteoarthritis.
16999949 2007 Serum prolidase activity and oxidative status in Helicobacter pylori infection.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16097034 2005 Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC.
15878628 2005 N-benzyloxycarbonyl-L-proline: an in vitro and in vivo inhibitor of prolidase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15309682 2004 Characterization of a new PEPD allele causing prolidase deficiency in two unrelated patients: natural-occurrent mutations as a tool to investigate structure-function relationship.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12384772 2002 Mutation analysis of five new patients affected by prolidase deficiency: the lack of enzyme activity causes necrosis-like cell death in cultured fibroblasts.
11840567 2002 Cluster analysis of an extensive human breast cancer cell line protein expression map database.
10965990 2000 The mechanism of daunorubicin-induced inhibition of prolidase activity in human skin fibroblasts and its implication to impaired collagen biosynthesis.
9328822 1997 Prolidase activity in fibroblasts is regulated by interaction of extracellular matrix with cell surface integrin receptors.
9020526 1996 The role of prolidase as an enzyme participating in the metabolism of collagen.
8900231 1996 Expression and molecular analysis of mutations in prolidase deficiency.
8198124 1994 Four novel PEPD alleles causing prolidase deficiency.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2925654 1989 Primary structure and gene localization of human prolidase.
2881880 1987 Three-point linkage analysis employing C3 and 19cen markers assigns the myotonic dystrophy gene to 19q.
2705457 1989 Prolidase deficiency: biochemical classification of alleles.
2365824 1990 A single nucleotide change in the prolidase gene in fibroblasts from two patients with polypeptide positive prolidase deficiency. Expression of the mutant enzyme in NIH 3T3 cells.
1972707 1990 Structural organization of the gene for human prolidase (peptidase D) and demonstration of a partial gene deletion in a patient with prolidase deficiency.