Property Summary

NCBI Gene PubMed Count 66
PubMed Score 75.38
PubTator Score 73.01

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.500 9.1e-07
ependymoma -1.300 3.2e-02
osteosarcoma -1.201 5.8e-04
atypical teratoid / rhabdoid tumor -1.300 2.2e-05
glioblastoma -1.400 1.0e-02
group 4 medulloblastoma -1.300 4.3e-04
medulloblastoma, large-cell -1.400 1.6e-04
pediatric high grade glioma -1.100 7.4e-03

Protein-protein Interaction (2)

Gene RIF (50)

PMID Text
27045366 three techniques for the first time demonstrated the presence of the PELP1 in paraspinal muscles of patients with idiopathic scoliosis.
26825173 PELP1 interacted with GR to activate Brk expression.
26472563 we propose that PELP1/Ki-67 double high expression in tumors is an independent prognostic factor for predicting a poor outcome for patients with Triple-negative breast cancer
26428280 The diffuse and strong nuclear immunoreactivity of PELP1 in most cases suggests that PELP1 may be a molecular target for the treatment of triple-negative breast carcinoma
26211588 There are significantly higher amounts of PELP1 transcript and protein in tumor tissues in patients with non-small cell lung cancer.
26158753 There is mounting evidence that PELP1 plays key roles in several biological processes and its deregulation leads to the development of cancers.
25788226 Results show that PELP1 is highly phosphorylated in triple negative breast cancer cells and interacts with mutated Tp53 and E2F1 to differentially regulates their target gene expression.
24967003 PELP1 exhibits an oncogenic function in colorectal cancer through c-Src upregulation.
24859989 This review focuses on the interactive functions and therapeutic and prognostic significance of PELP1 in breast and prostate cancers.
24786831 The PELP1 interacts with p53, functions as p53-coactivator and is required for optimal activation of p53 target genes under genomic stress.
24752897 MacroH2A1 specifically recruits PELP1 to the promoters of macroH2A1 target genes, but macroH2A1 occupancy occurs independent of PELP1. This recruitment allows macroH2A1 and PELP1 to cooperatively regulate gene expression outcomes.
24688046 our data identified the PELP1-mTOR axis as a novel component of PELP1 oncogenic functions and suggest that mTOR inhibitor(s) will be effective chemotherapeutic agents for downregulating PELP1 oncogenic functions.
24627205 Overexpression of PELP1 in Chinese women with primary breast cancer appears to be associated with biomarkers of poor outcome; these results are similar to other reports based on Western populations.
24469035 unliganded PR-B enhanced proliferative responses to estradiol and IGF1 via scaffolding of ER-alpha/PELP1/IGF1R-containing complexes
24447537 PELP1 oncogenic functions involve alternative splicing via PRMT6.
23975430 PELP1 regulates tumor metastasis by controlling the expression and functions of the tumor metastasis suppressors miR-200a and miR-141
23486015 Inhibition of CARM1 decreases PELP1 oncogenic activity.
22992812 results suggest that PELP1/MNAR plays a role in endometrial cancer progression and metastasis
22403175 PELP1 may enable estradiol-induced androgen receptor (AR) signaling by forming a protein complex between AR, estrogen receptor beta, and PELP1 on the DNA, leading to the proliferation of prostate cancer cells in the absence of androgen.
22086908 PELP1 may be a potential therapeutic target for metastatic ER-negative breast cancer.
22082156 Knockdown of proline, glutamate and leucine rich protein 1 (PELP1) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
21735116 Univariate survival analysis revealed that high PELP1 expression was associated with worse prognosis in astrocytic brain tumors
21695158 proto-oncogene PELP1 plays a vital role in rDNA transcription
21421858 Results suggest that PELP1 signaling axis is a potential druggable target and liposomal PELP1-siRNA-DOPC could be used as a novel drug to prevent or treat ovarian metastasis.
21326211 These data define the PELP1-TEX10-WDR18 complex as a regulator of ribosome biogenesis and suggests that its SUMO-controlled distribution coordinates the rate of ribosome formation.
20448663 These results suggest that PELP1 is a reader of H3 methylation marks and has a crucial role in modulating the histone code at the ERalpha target genes.
19800002 PELP1 regulation of aromatase P450 (Cyp19), represent a novel mechanism for in situ estrogen synthesis leading to tumor proliferation by autocrine loop and open a new avenue for ablating local aromatase activity in breast tumors.
19495959 PELP1 protein expression is an independent prognostic predictor of shorter breast-cancer-specific survival and disease-free interval in breast cancer. Its elevated expression is positively associated with markers of poor outcome.
19478391 ERalpha is rarely expressed while ERbeta and PELP1/MNAR are involved in colorectal tumorigenesis.
19048289 Statistical analysis revealed an increase in PELP1 expression in myofibroblasts from normal mucosa through adenomas to colorectal carcinomas.
18950845 Observational study of gene-disease association. (HuGE Navigator)
18682536 MNAR interacts with glucocorticoid receptor(GR) in the nucleus but not cytoplasm and regulates GR transactivation in a complex manner depending on cell type. MNAR is capable of regulating both AF1 and AF2 functions of the GR independently.
18559538 Overexpression of PELP1 is associated with ovarian tumorigenesis
18505929 growth factor signals promote phosphorylation of ER coactivator PELP1 via PKA pathway, and such modification may have functional implications in breast tumors with deregulated growth factor signaling
18261753 MNAR plays an important role in ERa activation of Src/MAPK and PI3K/Akt signaling pathways [review]
18079323 PELP1 signaling and its interactions with growth factor signaling components and orphan nuclear reactors may locally influence production of estradiol and promote tumor growth by promoting estrogen receptor autocrine signaling.
17804729 PELP1 and HRS reallocate to autophagosomes in response to resveratrol treatment, which might be important in the process of autophagy in the cancer cells.
17545633 Data suggest that PELP1 is a potential oncogene, that its expression is deregulated during cancer progression, and that PELP1 may play a role in oncogenesis.
17192406 PELP1 functions as a molecular adaptor, coupling FHL2 with nuclear receptors, and PELP1-FHL2 interactions may have a role in prostate cancer progression.
17128415 PELP1/MNAR may contribute to the tumorigenic potential of cancer cells by serving as a scaffolding protein that couples various signaling complexes with Estrogen Receptors (review)
16826428 PELP1/MNAR increases estradiol-mediated cell proliferation and participates in estradiol mediated tumorigenesis and metastasis. [REVIEW]
16352611 role of HRS in up-regulating MAPK, presumably involving interaction with PELP1.
16297421 Presence of MNAR in the cell nucleus indicates that it may play a role in regulation of gene expression.
16140940 Results suggest that the altered localization of PELP1 modulates sensitivity to antiestrogens, potentiates tumorigenicity via the activation of MAPK and AKT, and enhances cross-regulation of ER transactivation activity by growth factors.
16021574 PELP1 / MNAR and estrogen receptor beta are coexpressed in most salivary duct carcinoma and may play a role in the pathobiology of these tumors.
15579769 PELP1 expression and localization are widely deregulated in endometrial cancers. PELP1 and ERbeta were localized predominantly in cytoplasm of high-grade endometrial tumors. PELP1 may play essential role in proliferation of cancerous endometrial cells.
15456770 PELP1 recruits HDAC2 and masks histones using two separate domains
15374949 Results provide novel insights about the transcription regulation of PELP1 and suggest that PELP1 participates in chromatin remodeling activity via displacement of histone 1 in cancer cells.
12682072 PELP1, a steroid coactivator, plays a permissive role in E2-mediated cell cycle progression, presumably via its regulatory interaction with the pRb pathway
11481323 PELP1 is a coactivator of estrogen receptor (ER), interacts with ER, and may have a role in mammary tumorigenesis.

AA Sequence

MAAAVLSGPSAGSAAGVPGGTGGLSAVSSGPRLRLLLLESVSGLLQPRTGSAVAPVHPPNRSAPHLPGLM      1 - 70
CLLRLHGSVGGAQNLSALGALVSLSNARLSSIKTRFEGLCLLSLLVGESPTELFQQHCVSWLRSIQQVLQ     71 - 140
TQDPPATMELAVAVLRDLLRYAAQLPALFRDISMNHLPGLLTSLLGLRPECEQSALEGMKACMTYFPRAC    141 - 210
GSLKGKLASFFLSRVDALSPQLQQLACECYSRLPSLGAGFSQGLKHTESWEQELHSLLASLHTLLGALYE    211 - 280
GAETAPVQNEGPGVEMLLSSEDGDAHVLLQLRQRFSGLARCLGLMLSSEFGAPVSVPVQEILDFICRTLS    281 - 350
VSSKNISLHGDGPLRLLLLPSIHLEALDLLSALILACGSRLLRFGILIGRLLPQVLNSWSIGRDSLSPGQ    351 - 420
ERPYSTVRTKVYAILELWVQVCGASAGMLQGGASGEALLTHLLSDISPPADALKLRSPRGSPDGSLQTGK    421 - 490
PSAPKKLKLDVGEAMAPPSHRKGDSNANSDVCAAALRGLSRTILMCGPLIKEETHRRLHDLVLPLVMGVQ    491 - 560
QGEVLGSSPYTSSRCRRELYCLLLALLLAPSPRCPPPLACALQAFSLGQREDSLEVSSFCSEALVTCAAL    561 - 630
THPRVPPLQPMGPTCPTPAPVPPPEAPSPFRAPPFHPPGPMPSVGSMPSAGPMPSAGPMPSAGPVPSARP    631 - 700
GPPTTANHLGLSVPGLVSVPPRLLPGPENHRAGSNEDPILAPSGTPPPTIPPDETFGGRVPRPAFVHYDK    701 - 770
EEASDVEISLESDSDDSVVIVPEGLPPLPPPPPSGATPPPIAPTGPPTASPPVPAKEEPEELPAAPGPLP    771 - 840
PPPPPPPPVPGPVTLPPPQLVPEGTPGGGGPPALEEDLTVININSSDEEEEEEEEEEEEEEEEEEEEEDF    841 - 910
EEEEEDEEEYFEEEEEEEEEFEEEFEEEEGELEEEEEEEDEEEEEELEEVEDLEFGTAGGEVEEGAPPPP    911 - 980
TLPPALPPPESPPKVQPEPEPEPGLLLEVEEPGTEEERGADTAPTLAPEALPSQGEVEREGESPAAGPPP    981 - 1050
QELVEEEPSAPPTLLEEETEDGSDKVQPPPETPAEEEMETETEAEALQEKEQDDTAAMLADFIDCPPDDE   1051 - 1120
KPPPPTEPDS                                                               1121 - 1130
//

Text Mined References (78)

PMID Year Title
27045366 2016 Expression of Estrogen Receptor Coactivator Proline-, Glutamic Acid- and Leucine-Rich Protein 1 within Paraspinal Muscles in Adolescents with Idiopathic Scoliosis.
26825173 2016 Breast Tumor Kinase (Brk/PTK6) Is Induced by HIF, Glucocorticoid Receptor, and PELP1-Mediated Stress Signaling in Triple-Negative Breast Cancer.
26472563 2015 Prognostic significance of proline, glutamic acid, leucine rich protein 1 (PELP1) in triple-negative breast cancer: a retrospective study on 129 cases.
26428280 2015 Significantly increased PELP1 protein expression in primary and metastatic triple-negative breast carcinoma: comparison with GATA3 expression and PELP1's potential role in triple-negative breast carcinoma.
26211588 2015 Increased expression of proline-, glutamic acid- and leucine-rich protein PELP1 in non-small cell lung cancer.
26158753 2015 Minireview: Deciphering the Cellular Functions of PELP1.
25788226 2015 Novel role of PELP1 in regulating chemotherapy response in mutant p53-expressing triple negative breast cancer cells.
24967003 2014 PELP1 suppression inhibits colorectal cancer through c-Src downregulation.
24859989 2014 The social network of PELP1 and its implications in breast and prostate cancers.
24786831 2014 Proline, glutamic acid and leucine-rich protein-1 is essential for optimal p53-mediated DNA damage response.
24752897 2014 The histone variant MacroH2A1 regulates target gene expression in part by recruiting the transcriptional coregulator PELP1.
24688046 2014 Inhibition of mTOR signaling reduces PELP1-mediated tumor growth and therapy resistance.
24627205 2014 The pattern of proline, glutamic acid, and leucine-rich protein 1 expression in Chinese women with primary breast cancer.
24469035 2015 Progesterone receptor-B enhances estrogen responsiveness of breast cancer cells via scaffolding PELP1- and estrogen receptor-containing transcription complexes.
24447537 2014 PELP1 oncogenic functions involve alternative splicing via PRMT6.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23975430 2014 Significance of PELP1/HDAC2/miR-200 regulatory network in EMT and metastasis of breast cancer.
23497172 2013 The prognostic value of estrogen receptor beta and proline-, glutamic acid- and leucine-rich protein 1 (PELP1) expression in ovarian cancer.
23486015 2013 PELP1 oncogenic functions involve CARM1 regulation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22992812 2012 PELP1/MNAR suppression inhibits proliferation and metastasis of endometrial carcinoma cells.
22872859 2012 Five friends of methylated chromatin target of protein-arginine-methyltransferase[prmt]-1 (chtop), a complex linking arginine methylation to desumoylation.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22403175 2012 Central role for PELP1 in nonandrogenic activation of the androgen receptor in prostate cancer.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22086908 2012 Significance of PELP1 in ER-negative breast cancer metastasis.
21735116 2012 Prognostic value of novel biomarkers in astrocytic brain tumors: nuclear receptor co-regulators AIB1, TIF2, and PELP1 are associated with high tumor grade and worse patient prognosis.
21695158 2011 Regulation of rDNA transcription by proto-oncogene PELP1.
21421858 2011 Therapeutic targeting of PELP1 prevents ovarian cancer growth and metastasis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21326211 2011 The SUMO system controls nucleolar partitioning of a novel mammalian ribosome biogenesis complex.
21269460 2011 Initial characterization of the human central proteome.
20448663 2010 PELP1 is a reader of histone H3 methylation that facilitates oestrogen receptor-alpha target gene activation by regulating lysine demethylase 1 specificity.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19800002 2010 Regulation of aromatase induction by nuclear receptor coregulator PELP1.
19495959 2010 The prognostic significance of PELP1 expression in invasive breast cancer with emphasis on the ER-positive luminal-like subtype.
19478391 2009 Expression of ERalpha, ERbeta and co-regulator PELP1/MNAR in colorectal cancer: prognostic significance and clinicopathologic correlations.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19048289 2009 Expression of estrogen receptor co-regulators NCoR and PELP1 in epithelial cells and myofibroblasts of colorectal carcinomas: cytoplasmic translocation of NCoR in epithelial cells correlates with better [corrected] prognosis.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18682536 2008 MNAR functionally interacts with both NH2- and COOH-terminal GR domains to modulate transactivation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18559538 2008 Role of PELP1/MNAR signaling in ovarian tumorigenesis.
18505929 2008 Growth factor regulation of estrogen receptor coregulator PELP1 functions via Protein Kinase A pathway.
18261753 2008 MNAR plays an important role in ERa activation of Src/MAPK and PI3K/Akt signaling pathways.
18079323 2008 Modulation of in situ estrogen synthesis by proline-, glutamic acid-, and leucine-rich protein-1: potential estrogen receptor autocrine signaling loop in breast cancer cells.
17804729 2007 Identifying the estrogen receptor coactivator PELP1 in autophagosomes.
17545633 2007 Oncogenic potential of the nuclear receptor coregulator proline-, glutamic acid-, leucine-rich protein 1/modulator of the nongenomic actions of the estrogen receptor.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17505058 2007 Estrogen induces expression of BCAS3, a novel estrogen receptor-alpha coactivator, through proline-, glutamic acid-, and leucine-rich protein-1 (PELP1).
17192406 2007 Proline-, glutamic acid-, and leucine-rich protein-1/modulator of nongenomic activity of estrogen receptor enhances androgen receptor functions through LIM-only coactivator, four-and-a-half LIM-only protein 2.
17128415 2007 Emerging significance of ER-coregulator PELP1/MNAR in cancer.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16826428 2006 Comprehensive analysis of recent biochemical and biologic findings regarding a newly discovered protein-PELP1/MNAR.
16574651 2006 9-cis-retinoic acid up-regulates expression of transcriptional coregulator PELP1, a novel coactivator of the retinoid X receptor alpha pathway.
16567619 2006 NXP-2 association with SUMO-2 depends on lysines required for transcriptional repression.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16352611 2006 Hepatocyte growth factor-regulated tyrosine kinase substrate (HRS) interacts with PELP1 and activates MAPK.
16297421 2006 Characterization of MNAR expression.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16140940 2005 Functional implications of altered subcellular localization of PELP1 in breast cancer cells.
16021574 2005 Novel estrogen receptor coactivator PELP1/MNAR gene and ERbeta expression in salivary duct adenocarcinoma: potential therapeutic targets.
15994929 2005 Proline-, glutamic acid-, and leucine-rich protein-1 is essential in growth factor regulation of signal transducers and activators of transcription 3 activation.
15960975 2005 Physical association and coordinate function of the H3 K4 methyltransferase MLL1 and the H4 K16 acetyltransferase MOF.
15579769 2004 Deregulation of estrogen receptor coactivator proline-, glutamic acid-, and leucine-rich protein-1/modulator of nongenomic activity of estrogen receptor in human endometrial tumors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456770 2004 The transcriptional corepressor, PELP1, recruits HDAC2 and masks histones using two separate domains.
15374949 2004 Potential role of a novel transcriptional coactivator PELP1 in histone H1 displacement in cancer cells.
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14963108 2004 Characterization of the interactions of estrogen receptor and MNAR in the activation of cSrc.
12682072 2003 Functional interactions between the estrogen receptor coactivator PELP1/MNAR and retinoblastoma protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12415108 2002 Estrogen receptor-interacting protein that modulates its nongenomic activity-crosstalk with Src/Erk phosphorylation cascade.
11481323 2001 Molecular cloning and characterization of PELP1, a novel human coregulator of estrogen receptor alpha.