Property Summary

NCBI Gene PubMed Count 23
PubMed Score 45.62
PubTator Score 15.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Rheumatoid Arthritis 1.100 1.1e-02
interstitial lung disease -1.300 2.4e-02
chronic lymphocytic leukemia 1.264 6.1e-03
psoriasis 1.800 7.2e-05
glioblastoma 1.300 1.5e-02
primary pancreatic ductal adenocarcinoma 1.793 9.7e-03
intraductal papillary-mucinous neoplasm ... 1.400 3.7e-02
lung cancer -1.500 4.1e-04
pancreatic cancer 1.200 3.1e-02
breast carcinoma -1.200 1.9e-20
spina bifida -1.638 4.8e-02
Breast cancer -2.300 1.0e-14
mucosa-associated lymphoid tissue lympho... 1.397 1.0e-02
ovarian cancer 2.300 5.0e-05
pituitary cancer -2.100 3.7e-07
chronic rhinosinusitis -1.659 9.2e-03

Protein-protein Interaction (6)

Gene RIF (10)

PMID Text
25712248 The study results in the Chinese Han population showed that PELI1 is a member of a constellation of genetic factors that may contribute to the pathogenesis of systemic lupus erythematosus.
25295537 Increased PELI1 expression and subsequent induction of BCL6 promotes lymphomagenesis.
25027698 Peptide PEL1 derived from the interleukin-1 receptor-associated kinase (IRAK)1-binding motif reveals a distinct phosphothreonine peptide binding preference.
23921680 GWAS study found two new SNPs associated with nickel dermatitis; SNPs are located in the NTN4 and PELI1 genes
23846693 Pellino1 interacts with the transcription factor Deformed Epidermal Autoregulatory Factor 1 (DEAF1).
22105492 incomplete KD, IVIG nonresponsiveness, long febrile days, and the rs7604693 genetic variant in the PELI1 gene are major risk factors for the development of CALs
18976975 Knockdown of pellino E3 ubiquitin protein ligase 1 (PELI1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17675297 kinase-inactive IRAK proteins can associate with Pellino proteins, thus excluding the possibility that their inability to regulate Pellino degradation is due to lack of association with the Pellino proteins
16951688 Smad6 bound to Pellino-1 promoted TGF-beta-mediated anti-inflammatory effects.
12496252 role in interleukin-1-mediated signalling through interaction with interleukin-1 receptor-associated kinase 4-IRAK-tumor necrosis factor receptor-associated factor 6 complex

AA Sequence

MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAIS      1 - 70
NKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACR     71 - 140
IICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREIS    141 - 210
VCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARP    211 - 280
QCPVGFNTLAFPSMKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCE    281 - 350
AGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD      351 - 418
//

Text Mined References (24)

PMID Year Title
25712248 2015 Association of PELI1 polymorphisms in systemic lupus erythematosus susceptibility in a Chinese population.
25416956 2014 A proteome-scale map of the human interactome network.
25295537 2014 Pellino 1 promotes lymphomagenesis by deregulating BCL6 polyubiquitination.
25027698 2014 The pellino e3 ubiquitin ligases recognize specific phosphothreonine motifs and have distinct substrate specificities.
23921680 2013 A genome-wide association study in Koreans identifies susceptibility loci for allergic nickel dermatitis.
23846693 2013 DEAF1 is a Pellino1-interacting protein required for interferon production by Sendai virus and double-stranded RNA.
22105492 2012 Assessment of risk factors for Korean children with Kawasaki disease.
21221998 2011 A genome-wide association analysis reveals 1p31 and 2p13.3 as susceptibility loci for Kawasaki disease.
21120624 2011 Pellino-1, an adaptor protein of interleukin-1 receptor/toll-like receptor signaling, is sumoylated by Ubc9.
17997719 2008 The IRAK-catalysed activation of the E3 ligase function of Pellino isoforms induces the Lys63-linked polyubiquitination of IRAK1.
17675297 2007 Kinase-active interleukin-1 receptor-associated kinases promote polyubiquitination and degradation of the Pellino family: direct evidence for PELLINO proteins being ubiquitin-protein isopeptide ligases.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16951688 2006 Smad6 negatively regulates interleukin 1-receptor-Toll-like receptor signaling through direct interaction with the adaptor Pellino-1.
16884718 2006 Pellino proteins are more than scaffold proteins in TLR/IL-1R signalling: a role as novel RING E3-ubiquitin-ligases.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15917247 2005 Pellino3 is a novel upstream regulator of p38 MAPK and activates CREB in a p38-dependent manner.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12804775 2003 Pellino2 activates the mitogen activated protein kinase pathway.
12496252 2003 Pellino 1 is required for interleukin-1 (IL-1)-mediated signaling through its interaction with the IL-1 receptor-associated kinase 4 (IRAK4)-IRAK-tumor necrosis factor receptor-associated factor 6 (TRAF6) complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11306823 2001 Assignment of homologous genes, Peli1/PELI1 and Peli2/PELI2, for the Pelle adaptor protein Pellino to mouse chromosomes 11 and 14 and human chromosomes 2p13.3 and 14q21, respectively, by physical and radiation hybrid mapping.
11132151 2000 Pellino-related sequences from Caenorhabditis elegans and Homo sapiens.