Property Summary

NCBI Gene PubMed Count 40
PubMed Score 363.53
PubTator Score 194.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
osteosarcoma 3.464 1.0e-02
posterior fossa group B ependymoma -1.500 6.9e-07
adrenocortical carcinoma -1.405 4.7e-02
intraductal papillary-mucinous adenoma (... -1.100 1.5e-03
Hydrolethalus syndrome -2.078 2.1e-02
lung cancer 4.400 7.9e-07
colon cancer -2.300 1.0e-06
Breast cancer 3.400 4.7e-02
interstitial cystitis -3.500 9.1e-06
atypical teratoid/rhabdoid tumor 1.500 2.9e-02
group 4 medulloblastoma 1.800 1.8e-02
pilocytic astrocytoma -1.100 1.0e-04
subependymal giant cell astrocytoma -3.098 4.3e-03
invasive ductal carcinoma -1.805 2.0e-03
lung carcinoma 2.500 1.8e-22
non-small cell lung carcinoma -1.100 1.7e-07
Pick disease -1.900 3.6e-04
pituitary cancer 1.400 1.6e-02
Down syndrome 1.800 2.7e-03

Gene RIF (25)

PMID Text
26680220 important role in trophoblast proliferation and promotes trophoblast invasion through TIMP-1
25526181 The downregulated expression of the imprinted gene PEG10 may be an important reason for the occurrence of preeclampsia.
25199998 Results revealed that PEG10 high expression was closely associated with the TNM classification in lung cancer and is a critical indicator for poor prognosis. Also, It promotes significantly proliferation, migration and invasion of A549 lung cancer cells.
22673314 promotes migration of Burkitt's lymphoma cells via upregulation of matrix metalloproteinase-2 and -9
22137777 elevated expression of PEG10 is likely to be involved in the pathophysiology of preeclampsia
21767414 the mRNA expression level of PEG10 were significantly up-regulated in tumorous liver tissues compared with corresponding nontumorous counterparts.
21455631 Overexpression of PEG10 and TSG101 was detected in gallbladder adenocarcinoma.
21205473 PEG10 imprinting is lost in a majority of hepatocellular carcinomas and no correlation exists between the imprinting status of PEG10 and its expression in HCC tissues.
20484977 In third trimester PEG10 was downregulated in fetal samples group
20460050 miR-122 may be involved in regulation of PEG10 expression hepatoma cell lines.
20362226 PEG10 is a probable target, acting as a driving force for amplification of the 7q21 region, and may therefore be involved in the development or progression of hepatocellular carcinomas.
20084274 study provides new data on the genomic organization as well as expression and translation of PEG10, a prerequisite in order to study and understand the role of PEG10 in cancer, embryonic development and normal cell homeostasis
20084274 Evidence for translation initiation from an in-frame, upstream non-AUG (CUG) codon, and from the downstream AUG, resulting in different isoforms.
18625225 The expression profile of hepatocelluar carcinoma tissues suggested E2Fs were involved in PEG10 regulation.
18550496 The results showed that maintaining sufficient levels of PEG10 may be important during early pregnancy. Lower levels of PEG10 might be one of reasons that underlie inevitable abortion.
17942406 the ORF1-2 protein of PEG10, synthesized utilizing the most efficient -1 frameshift mechanism yet documented in vivo, will have an essential function that is intrinsic to the importance of PEG10 in mammals
17621626 PEG10 represents a novel marker in B-cell chronic lymphocytic leukemia
16423995 PEG10 is a direct target of c-MYC; findings link cancer genetics and epigenetics by showing that a classic proto-oncogene, MYC, acts directly upstream of a proliferation-positive imprinted gene, PEG10
16225771 Data show that CXCL13 and CCL19 together by means of activation of CXCR5 and CCR7 up-regulated PEG10 expression and function in leukemic B cells.
15767280 Programmed -1 ribosomal frameshifting in mouse and human Peg10 genes.
15611116 PEG10 contains two overlapping reading frames from which two proteins are translated by a -1 ribosomal frameshift mechanism.
14576465 Results indicate that the induction of the imprinted gene paternally expressed 10 (PEG10) may play an important role during liver regeneration or carcinogenesis of the human hepatocyte.
12810624 Exogenous expression of PEG10 conferred oncogenic activity. PEG10 protein associated with SIAH1, a mediator of apoptosis, and overexpression of PEG10 decreased the cell death mediated by SIAH1.
12620933 placental PEG10 is downregulated at early hypoxic phase, and highly activated at 11-12 wk of gestation
11318613 PEG10 gene is imprinted, with preferential expression from the paternal allele.

AA Sequence

MTERRRDELSEEINNLREKVMKQSEENNNLQSQVQKLTEENTTLREQVEPTPEDEDDDIELRGAAAAAAP      1 - 70
PPPIEEECPEDLPEKFDGNPDMLAPFMAQCQIFMEKSTRDFSVDRVRVCFVTSMMTGRAARWASAKLERS     71 - 140
HYLMHNYPAFMMEMKHVFEDPQRREVAKRKIRRLRQGMGSVIDYSNAFQMIAQDLDWNEPALIDQYHEGL    141 - 210
SDHIQEELSHLEVAKSLSALIGQCIHIERRLARAAAARKPRSPPRALVLPHIASHHQVDPTEPVGGARMR    211 - 280
LTQEEKERRRKLNLCLYCGTGGHYADNCPAKASKSSPAGKLPGPAVEGPSATGPEIIRSPQDDASSPHLQ    281 - 350
VMLQIHLPGRHTLFVRAMIDSGASGNFIDHEYVAQNGIPLRIKDWPILVEAIDGRPIASGPVVHETHDLI    351 - 420
VDLGDHREVLSFDVTQSPFFPVVLGVRWLSTHDPNITWSTRSIVFDSEYCRYHCRMYSPIPPSLPPPAPQ    421 - 490
PPLYYPVDGYRVYQPVRYYYVQNVYTPVDEHVYPDHRLVDPHIEMIPGAHSIPSGHVYSLSEPEMAALRD    491 - 560
FVARNVKDGLITPTIAPNGAQVLQVKRGWKLQVSYDCRAPNNFTIQNQYPRLSIPNLEDQAHLATYTEFV    561 - 630
PQIPGYQTYPTYAAYPTYPVGFAWYPVGRDGQGRSLYVPVMITWNPHWYRQPPVPQYPPPQPPPPPPPPP    631 - 700
PPPSYSTL                                                                  701 - 708
//

Text Mined References (46)

PMID Year Title
26680220 2015 Silencing of Paternally Expressed Gene 10 Inhibits Trophoblast Proliferation and Invasion.
25526181 2014 Expression and significance of the imprinted gene PEG10 in placenta of patients with preeclampsia.
25416956 2014 A proteome-scale map of the human interactome network.
25199998 2014 PEG10 plays a crucial role in human lung cancer proliferation, progression, prognosis and metastasis.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22673314 2012 PEG10 promotes the migration of human Burkitt's lymphoma cells by up-regulating the expression of matrix metalloproteinase-2 and -9.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22137777 2012 Elevated expression of PEG10 in human placentas from preeclamptic pregnancies.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21767414 2011 Digital karyotyping reveals probable target genes at 7q21.3 locus in hepatocellular carcinoma.
21455631 2011 Identification of PEG10 and TSG101 as carcinogenesis, progression, and poor-prognosis related biomarkers for gallbladder adenocarcinoma.
21269460 2011 Initial characterization of the human central proteome.
21205473 2010 [The imprinting status of genetic imprinted gene PEG10 in human hepatocellular carcinomas].
20484977 2010 Gene expression pattern of IGF2, PHLDA2, PEG10 and CDKN1C imprinted genes in spontaneous miscarriages or fetal deaths.
20460050 2010 [MiR-122 regulates the expression of PEG10 in hepatoma cell lines].
20362226 2010 PEG10 is a probable target for the amplification at 7q21 detected in hepatocellular carcinoma.
20084274 2010 Genetic and molecular analyses of PEG10 reveal new aspects of genomic organization, transcription and translation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18625225 2008 PEG10 directly regulated by E2Fs might have a role in the development of hepatocellular carcinoma.
18550496 2008 [Genetic imprinted gene PEG10 expression in deciduas from inevitable abortion].
17942406 2007 Mammalian gene PEG10 expresses two reading frames by high efficiency -1 frameshifting in embryonic-associated tissues.
17621626 2007 Overexpression of the paternally expressed gene 10 (PEG10) from the imprinted locus on chromosome 7q21 in high-risk B-cell chronic lymphocytic leukemia.
17369855 2007 Androgen activates PEG10 to promote carcinogenesis in hepatic cancer cells.
16423995 2006 PEG10 is a c-MYC target gene in cancer cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16225771 2004 PEG10 activation by co-stimulation of CXCR5 and CCR7 essentially contributes to resistance to apoptosis in CD19+CD34+ B cells from patients with B cell lineage acute and chronic lymphocytic leukemia.
16093683 2005 A family of neofunctionalized Ty3/gypsy retrotransposon genes in mammalian genomes.
16053381 2005 Allelic variation in gene expression in thyroid tissue.
15767280 2005 Characterization of the frameshift signal of Edr, a mammalian example of programmed -1 ribosomal frameshifting.
15716091 2005 Transposable elements as a source of genetic innovation: expression and evolution of a family of retrotransposon-derived neogenes in mammals.
15611116 2005 Human retroviral gag- and gag-pol-like proteins interact with the transforming growth factor-beta receptor activin receptor-like kinase 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14576465 2003 Overexpression of a novel imprinted gene, PEG10, in human hepatocellular carcinoma and in regenerating mouse livers.
12853948 2003 The DNA sequence of human chromosome 7.
12810624 2003 Involvement of PEG10 in human hepatocellular carcinogenesis through interaction with SIAH1.
12620933 2003 Temporal regulation of the expression of syncytin (HERV-W), maternally imprinted PEG10, and SGCE in human placenta.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11574691 2001 Identification and characterisation of a developmentally regulated mammalian gene that utilises -1 programmed ribosomal frameshifting.
11318613 2001 A retrotransposon-derived gene, PEG10, is a novel imprinted gene located on human chromosome 7q21.
11158386 2001 Ty3/Gypsy retrotransposon fossils in mammalian genomes: did they evolve into new cellular functions?
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.