Property Summary

NCBI Gene PubMed Count 15
PubMed Score 41.83
PubTator Score 14.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -3.300 1.1e-08
psoriasis -2.000 2.5e-53
Atopic dermatitis -1.300 5.7e-03
tuberculosis 1.200 2.3e-05
pancreatic ductal adenocarcinoma liver m... -1.271 1.3e-03
ductal carcinoma in situ -1.700 8.6e-04
invasive ductal carcinoma -1.400 1.4e-02
ulcerative colitis -1.100 3.9e-04
ovarian cancer 1.100 5.5e-09

Protein-protein Interaction (4)

Gene RIF (3)

PMID Text
22745130 Biochemical studies and structural analysis suggest that pDCRs can catalyze the shortening of six-carbon-long substrates in vitro.
20463177 Observational study of gene-disease association. (HuGE Navigator)
16546181 Human trans-2-enoyl-CoA reductase (TER) is responsible for the reduction of phytenoyl-CoA to phytanoyl-CoA in peroxisomes.

AA Sequence

MASWAKGRSYLAPGLLQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTK      1 - 70
QARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCK     71 - 140
AVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAV    141 - 210
ENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNW    211 - 280
PKGAGDLSVVKKMKETFKEKAKL                                                   281 - 303
//

Text Mined References (17)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22745130 2012 Studies of human 2,4-dienoyl CoA reductase shed new light on peroxisomal ?-oxidation of unsaturated fatty acids.
20463177 2010 Multistudy fine mapping of chromosome 2q identifies XRCC5 as a chronic obstructive pulmonary disease susceptibility gene.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
19581569 2009 Genome-wide association study of alcohol dependence.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16546181 2006 Peroxisomal trans-2-enoyl-CoA reductase is involved in phytol degradation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11937624 2002 Ku86 autoantigen related protein-1 transcription initiates from a CpG island and is induced by p53 through a nearby p53 response element.
11827452 2002 Gene expression profile of human bone marrow stromal cells: high-throughput expressed sequence tag sequencing analysis.
11669066 2001 Identification of a novel human peroxisomal 2,4-dienoyl-CoA reductase related protein using the M13 phage protein VI phage display technology.
11043578 2000 The LIM/homeodomain protein islet-1 modulates estrogen receptor functions.
10811639 2000 Molecular cloning and expression of mammalian peroxisomal trans-2-enoyl-coenzyme A reductase cDNAs.