Property Summary

NCBI Gene PubMed Count 28
PubMed Score 22.53
PubTator Score 27.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
posterior fossa group B ependymoma 3.000 9.3e-13
sonic hedgehog group medulloblastoma -1.600 5.2e-06
Duchenne muscular dystrophy -1.380 1.3e-07
autosomal dominant Emery-Dreifuss muscul... -1.310 2.4e-04
juvenile dermatomyositis -1.352 1.1e-08
acute quadriplegic myopathy -1.931 1.6e-05
non-small cell lung cancer -4.613 7.6e-32
lung adenocarcinoma -2.900 7.3e-12
atypical teratoid/rhabdoid tumor -1.100 8.8e-05
lung carcinoma -4.000 3.2e-31
gastric carcinoma -1.700 1.1e-02
psoriasis -2.000 4.4e-55

Synonym

Accession Q96S96 Q5EVA1 Q8WW74 PEBP-4
Symbols CORK1
CORK-1
PEBP-4
hPEBP4
PRO4408
GWTM1933
HEL-S-300

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (19)

PMID Text
27033522 PEBP4 is a secreted protein and has multiple functions, including a role in Akt phosphorylation.
25721211 Increased miR-15b expression in lung adenocarcinoma patients treated with cisplatin-based chemotherapy was correlated with low expression of PEBP4, decreased sensitivity to cisplatin and poor prognosis.
25038915 overexpression of PEBP4, which we show to be a target of miR-34a, reduces the sensitivity of lung cancer cells to cisplatin
24594691 concluded that hPEBP4, specifically expressed in rectal cancer cells, is associated with radioresistance of rectal cancer
24276246 in human breast cancer hPEBP4 is a novel and clinically relevant metastasis accelerator gene
23818363 Human PEBP4 expression correlates negatively with estrogen and progesterone receptors in endometrial carcinoma.
23451095 hPEBP4 knockdown potentiated the chemosensitization of the rituximab in B-cell lymphoma cells by regulating the expression of Bcl-xl, Cycline E, p21(waf/cip1) and p53 and the activation of caspase-3 and caspase-9.
22983920 PEBP4 enhanced cell proliferation and invasion ability and inhibited apoptosis. Decreased PEBP4 expression may play a role in the reduced invasion ability and increased apoptosis of the human non-small cell lung cancer cell line HCC827.
22801881 the independent predictive values of hPEBP4 in response of rectal cancer to preoperative radiotherapy, are reported.
22125029 The over-expression of PEBP4 protein may be related to the tumorigenesis, development, metastasis, and invasion of colorectal cancer.
22076923 PEBP4 over-expression may promote the invasion and metastasis of non-small cell lung cancer.
21887552 Data show that PEBP4 protein overexpression was associated with the occurrence, invasion, and metastasis of lung squamous cell carcinoma.
20460377 hPEBP4 inhibits proteasome-dependent ERalpha degradation through the Src pathway.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
19197339 Data show that PEBP4 participates in the control of muscle cell differentiation by modulating the activity of MEK and ERK.
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16865237 Silencing of hPEBP4, an important potential target, may be a promising approach for the treatment of ovarian cancer.
15302887 hPEBP4 promotes cellular resistance to TNF-induced apoptosis by inhibiting activation of the Raf-1/MEK/ERK pathway, JNK, and PE externalization.

AA Sequence

MGWTMRLVTAALLLGLMMVVTGDEDENSPCAHEALLDEDTLFCQGLEVFYPELGNIGCKVVPDCNNYRQK      1 - 70
ITSWMEPIVKFPGAVDGATYILVMVDPDAPSRAEPRQRFWRHWLVTDIKGADLKKGKIQGQELSAYQAPS     71 - 140
PPAHSGFHRYQFFVYLQEGKVISLLPKENKTRGSWKMDRFLNRFHLGEPEASTQFMTQNYQDSPTLQAPR    141 - 210
ERASEPKHKNQAEIAAC                                                         211 - 227
//

Text Mined References (28)

PMID Year Title
27033522 2016 Phosphatidylethanolamine binding protein 4 (PEBP4) is a secreted protein and has multiple functions.
25721211 2015 miR-15b regulates cisplatin resistance and metastasis by targeting PEBP4 in human lung adenocarcinoma cells.
25038915 2014 Downregulation of PEBP4, a target of miR-34a, sensitizes drug-resistant lung cancer cells.
24839885 2014 A genome-wide association meta-analysis of preschool internalizing problems.
24594691 2014 Human phosphatidylethanolamine-binding protein 4 promoted the radioresistance of human rectal cancer by activating Akt in an ROS-dependent way.
24276246 2014 Phosphatidylethanolamine-binding protein 4 is associated with breast cancer metastasis through Src-mediated Akt tyrosine phosphorylation.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
23818363 Expression of hPEBP4 negatively correlates with estrogen and progesterone receptors in endometrial carcinoma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23451095 2013 Silencing of human phosphatidylethanolamine-binding protein 4 enhances rituximab-induced death and chemosensitization in B-cell lymphoma.
22983920 2013 PEBP4 enhanced HCC827 cell proliferation and invasion ability and inhibited apoptosis.
22801881 2013 hPEBP4 as a predictive marker for the pathological response of rectal cancer to preoperative radiotherapy.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22125029 2012 Expression of PEBP4 protein correlates with the invasion and metastasis of colorectal cancer.
22076923 2012 PEBP4 gene expression and its significance in invasion and metastasis of non-small cell lung cancer.
21887552 2011 The expression of PEBP4 protein in lung squamous cell carcinoma.
20460377 2010 Human phosphatidylethanolamine-binding protein 4 promotes transactivation of estrogen receptor alpha (ERalpha) in human cancer cells by inhibiting proteasome-dependent ERalpha degradation via association with Src.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19197339 2009 Regulation of human myoblast differentiation by PEBP4.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
16865237 2006 Anti-apoptotic hPEBP4 silencing promotes TRAIL-induced apoptosis of human ovarian cancer cells by activating ERK and JNK pathways.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15302887 2004 A novel human phosphatidylethanolamine-binding protein resists tumor necrosis factor alpha-induced apoptosis by inhibiting mitogen-activated protein kinase pathway activation and phosphatidylethanolamine externalization.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.