Property Summary

NCBI Gene PubMed Count 186
PubMed Score 456.79
PubTator Score 383.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
chronic lymphocytic leukemia 1.312 1.2e-03
Multiple myeloma 1.127 1.4e-03
astrocytic glioma -1.300 4.8e-02
psoriasis -1.100 1.8e-04
atypical teratoid / rhabdoid tumor -1.200 1.1e-08
pancreatic ductal adenocarcinoma liver m... -2.028 8.3e-03
intraductal papillary-mucinous carcinoma... -1.500 1.5e-03
intraductal papillary-mucinous neoplasm ... -1.300 2.6e-03
lung cancer 1.300 1.8e-03
interstitial cystitis -1.100 2.9e-04
ovarian cancer 1.700 9.0e-05

 MGI Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (150)

PMID Text
26859895 report of the expression profile of RKIP in a heterogeneous group of soft tissue sarcomas; findings showed that only a small subset of cases exhibited RKIP loss, yet its loss is an independent biomarker of prognosis
26823735 RKIP inhibits glioma cell migration and invasivess by inhibiting MMP2/MMP9/HMAG2 expression.
26716415 Loss of RKIP is associated with neoplasms.
26617724 Downregulation or depletion of RKIP was related to the onset and progression of esophageal squamous cell carcinoma, and facilitated the invasion and metastasis of ESCC by downregulating E-cadherin and upregulating NF-kB p65.
26558823 Identify intestinal RKIP as capable of hydrolyzing prasugrel to its thiolactone metabolite.
26479924 RKIP is upregulated in heart failure.
26308852 RKIP Inhibits Local Breast Cancer Invasion by Antagonizing the Transcriptional Activation of MMP13
26238785 In triple negative breast cancer, RKIP regulates tumor-associated macrophage recruitment by blocking HMGA2, resulting in reduced expression of numerous macrophage chemotactic factors, including CCL5.
26238523 Study indicates that reduced RKIP expression is correlated with metastasis and recurrence of disease in stage II colorectal cancer (CRC) suggesting it as an important metastasis-suppressor gene in CRC.
26177829 The upregulated expression of RKIP in colorectal cancer cells inhibited cell invasion and metastasis, while downregulation of RKIP reduced chemosensitivity by inhibiting apoptosis induced by HCPT.
26116914 Raf kinase inhibitor protein mediated signaling inhibits invasion and metastasis of hepatocellular carcinoma.
25915430 RKIP is a metastatic suppressor and predictor for metastasis and prognosis in nasopharyngeal carcinoma, and RKIP downregulation promotes nasopharyngeal carcinoma invasion, metastasis and epithelial to mesenchymal transition by activating Stat3 signaling
25819500 This study showed that elevated amygdala HCNP-pp expression may contribute to mechanisms of major depression in women.
25597357 Here, we present a three-state model to explain the RKIP functional switch and discuss the role of the pocket loop in regulating RKIP activity. [review]
25597355 RKIP loss is a frequent occurrence in many solid tumor cancers and may serve as a viable prognostic biomarker. [review]
25597354 Here, we review RKIP's role as a metastasis suppressor and the signaling networks and genes regulated by RKIP in metastatic, triple-negative breast cancer. [review]
25597353 This brief review describes the role of RKIP in the regulation of drug sensitivity via disruption of the NF-kappaB/Snail/ YY1/RKIP loop that regulates resistance in cancer cells. [review]
25597352 Genetic an epigenetic control of RKIP transcription and review of known mechanisms employed by different types of chemotherapeutic agents to activate RKIP expression in cancer cells.[review]
25597351 Fine control of RKIP activity and regulation is crucial to avoid pathological processes, such as metastasis,pulmonary arterial hypertension, and heart failure.[review]
25547433 The overexpression of RKIP can enhance the sensitivity of human gastric cancer cells to cisplatin, which may be achieved via the NF-kappaB/Snail signaling pathway.
25337233 Data suggest that RKIP inhibits gastric cancer metastasis via the downregulation of its downstream target genes STAT3 and cyclin D1.
25329396 functional RKIP rs17512051 polymorphism may affect ccRCC susceptibility
25277181 downregulation of RKIP occurs frequently... suggesting RKIP being a critical tumor suppressor for clear cell renal cell carcinomas
25172097 RKIP inhibits gastric cancer cell survival and invasion by regulating the expression of HMGA2 and OPN.
25171481 Loss of RKIP expression was associated with unfavorable OS.
25128483 Results suggest that up-regulation of miR-27a could suppress RKIP expression and in turn contribute to chemoresistance of lung adenocarcinoma cells to cisplatin.
25017365 down-regulation of RKIP expression was observed in human gastric cell lines, and miR-224 could negatively regulate the expression and biological characteristics of RKIP, contributing to suppress the proliferation and invasion of gastric cells.
25015191 overexpression of RKIP could decrease the proliferation and increase the apoptosis of K562 cells.
24863296 Authors demonstrate that the N-terminus of human Raf1 kinase (hRaf11-147aa) binds with human RKIP (hRKIP) at its ligand-binding pocket, loop "127-149", and the C-terminal helix by nuclear magnetic resonance experiments.
24763848 Raf kinase inhibitor protein expression is a suitable and easily determinable marker in the primary tumour that could predict the risk of uveal melanoma to metastasize
24658061 RKIP synergizes with microtubule inhibitors to induce apoptosis and inhibit STAT3 activation of breast and prostate cancer cells. RKIP plays a critical role in opposing the effects of pro-oncogenic STAT3 activation.
24655025 RKIP expression could be involved in the suppression of NF-kappaB activation in Primary Sjogren syndrome salivary gland epithelial cells
24420151 The level of RKIP mRNA expression was found to be significantly downregulated in non-small cell lung cancers (NSCLC).
24395801 BACH1 acts in a double-negative (overall positive) feedback loop to inhibit RKIP transcription in breast cancer cells
24392454 Our findings newly described RKIP/miR-98 to HMGA2 link and provided a potential mechanism for glioma cell invasion
24335512 The expression of RKIP was significantly upregulated and the expression of bcl-2 was significantly downregulated in DHA-treated cells compared with control cells.
24330423 progressive loss of RKIP seems to play a major role in the neoplastic transformation of pancreas, correlates with aggressive features in PDAC and is associated with the presence of EMT in form of tumor budding
24123286 RKIP expression adds significant value to the molecular subclassification of breast cancer especially for the Luminal A subtype.
24048798 RKIP expression correlates with tumor grade and is a marker for good prognosis in high-grade gliomas.
23991415 Taking into account the PC phenotypes according to RKIP among PSA-PSMA profiles may improve distinguishing them from cancers that will become more aggressive.
23975428 RKIP, LOX and SDC2 are coordinately regulated and collectively encompass a prognostic signature for metastasis-free survival in ER-negative breast cancer patients
23959677 BP1 interacted with PC-PLC, positively regulated PC-PLC activity and negatively regulated autophagy in HUVECs.
23872143 This work may shed light on the underlying molecular mechanisms of how hRKIP recognizes and binds diverse substrate ligands.
23814485 A new p53 target gene, RKIP, is essential for DNA damage-induced cellular senescence and suppression of ERK activation.
23674108 RKIP inhibits esophageal cancer cell invasion by downregulating the expression of GRK-2, LIN28 and MMP-14.
23636063 Study shows that RKIP expression may be of some value as a marker for abnormal cervical cells.
23632477 The clinical relevance of RKIP expression as an independent prognostic factor is restricted to the tumour centre. Loss of RKIP predicts features of epithelial-mesenchymal transition and correlates with frequent distant metastasis.
23601922 Down-regulation of both RKIP and pRKIP expression could represent a useful marker of metastatic melanoma.
23527098 loss of RKIP expression can be one of the factors that are behind the aggressiveness, malignant progression and chemotherapy resistance of cervical cancer.
23460950 This demonstrates the potential utility of RKIP in identifying 'high-risk' Dukes' B patients
23376254 Loss of PEBP1 associates with clinical risk factors, but since with no significant influence on survival in gastrointestinal stromal tumor patients.
23359513 Review highlights recent advances in RKIP research, underscoring its potential role as master modulator of many pivotal intracellular signaling cascades that control cellular growth, motility, apoptosis, genomic integrity, and therapeutic resistance.
23284715 The yeast two-hybrid screen and the coimmunoprecipitation analysis identify the HIV-1 Nef interacting human protein phosphatidylethanolamine binding protein 1 (PEBP1) in cells
23259789 RKIP inhibited the migration and invasion of SGC7901 cells. Furthermore, we observed that RKIP inhibited the growth of SMGC7901 cells in xenografts in nude mice
23254962 The results show that RKIP is an independent prognostic factor for survival in patients with locoregionally advanced nasopharyngeal carcinoma
23095933 Androgens induce RKIP expression through androgen receptor-mediated transcriptional modulation of the RKIP promoter in the prostate.
23075684 deficiency of RKIP expression is positively correlated with carcinogenesis and invasion metastasis of NSCLC
23066640 RKIP may act as a tumor suppressor gene in esophageal cancer.
23066033 Findings establish RKIP as an inhibitor of MDA-9-dependent melanoma metastasis.
22983529 aberrant hypermethylation of RKIP may be one of the mechanisms that lead to loss or down expression of the gene in GCA especially in individuals with UGIC family history
22935977 In renal cell carcinoma, reduced RKIP expression is associated with tumour progression and metastasis. RKIP expression is a significant prognostic marker for patients with RCC.
22899242 The ERK/MAPK pathway is involved in the pathogenesis of gastric cancer; RKIP and 14-3-3epsilon exert an opposite effect on this pathway and the cells possibly via both direct and indirect reactions with the elements in this pathway.
22875620 Loss of RKIP gene is associated with acute monocytic leukemia.
22855160 the reduced expression of RKIP significantly correlated with both poor overall and disease-free survival in pancreatic cancer.
22833545 Treatment with recombinant human RKIP increased the migratory activity of MCF7 cells.
22809510 Taken together,these data indicate that miR-224 play an important role in metastasis of human breast cancer cells to the bone by directly suppressing the RKIP tumor suppressor.
22692503 Investigated the expression of RKIP and E-cadherin in lung squamous cell carcinoma tissue. The rates of positive RKIP and E-cadherin mRNA expression were significantly lower in lung squamous cell carcinoma than in the surrounding normal tissues.
22662230 H. pylori utilizes a tumor suppressor protein, RKIP, to promote apoptosis in gastric cancer cells.
22605662 RKIP could be identified as an independent prognostic factor on distant metastasis-free survival in locoregionally advanced nasopharyngeal carcinoma.
22562283 reduction of RKIP expression in hepatic colorectal metastasis had an independent predictive value for metastatic recurrence and less favorable clinical outcomes
22558375 ligand binding of PEBP1
22505648 EZH2 accelerates cancer cell invasion, in part, via RKIP inhibition
22492043 RKIP regulates MAPK/ERK signaling in the suprachiasmatic nucleus (SCN) and photic entrainment of the SCN clock.
22463874 loss of RKIP was associated with tumour progression and poor survival. Negative RKIP expression combined with positive p-ERK expression was an independent predictor of poor outcomes in patients with gastric cancer.
22460832 analysis of RAF-kinase inhibitor protein (RKIP) downregulation in esophageal cancer and its metastases
22388727 Our data show that RKIP is frequently lost in AML and correlates with monocytic phenotypes and mutations in RAS.
22373584 Data suggest that the Raf kinase inhibitor protein (RKIP) may play a role in inhibiting cellular proliferation and cell migration.
22295570 RKIP inhibits the migration and invasion ability of human prostate cancer cells through regulation of the extracellular matrix.
22292035 In a subset of tumors, the absence of RKIP associates with highly malignant behavior and poor survival of patients, which may be a useful biomarker for tailored treatment of glioma patients.
22279539 Data suggest that the NRF2-KEAP 1 pathway as a possible target for personalized therapeutic intervention in RKIP depleted cancers.
22248055 investigated the direct role of YY1 in the regulation of EMT. This review discusses the molecular regulation of EMT in cancer cells through the activity of the dysregulated NF-kappaB/Snail/ YY1/PTEN/RKIP circuitry
22246605 Data suggest that Low or absent Raf kinase inhibitor protein (RKIP) expression may be associated with the onset and development of gastric cancer and its ability to invade and metastasize.
22102006 Downregulation of RKIP protein is associated with recurrence in esophageal squamous cell carcinoma.
22031589 This study demonstrated for the first time that RKIP expression is lost during the carcinogenic evolution of endometrial tumours and that the loss of RKIP expression is associated with a malignant phenotype.
21875465 Down-regulation of RKIP expression may serve as a predictive marker for hepatocellular carcinoma development, progression and metastasis.
21873975 An RKIP pathway metastasis signature (designated RPMS) derived from the complete signalling cascade predicts high metastatic risk better than the individual genes.
21831839 Colocalization of Raf-1 to PEBP1 is low in asthmatic tissue and cells compared with normals, whereas there is striking colocalization of 15LO1 with PEBP1 in asthma.
21732351 Results provide evidence that RKIP is a novel factor expressed in cytotrophoblast cells where it likely regulates cell migration.
21689459 we found that phospho-RKIP was a predictive indicator of survival.
21685394 Rkip prevents cilia formation and is associated with Cep290-mediated photoreceptor degeneration.
21672326 RKIP may play a role in cervical-cancer genesis and metastasis; RKIP down-regulation was associated with metastatic disease in human cervical cancer.
21664646 In colorectal cancer progression, vascular endothelial growth factor overexpression seems to play a role in the tumor center, whereas Laminin5gamma2-positivity combined with Raf-1 kinase inhibitor protein loss is associated with tumor invasion at the front.
21617351 Downregulation of RKIP increased the level of free Raf-1 and thereby elevated the mitochondrial translocation of Raf-1 during HBx-mediated hepatocarcinogenesis.
21556737 RKIP may contribute to the production of metalloproteinases, IL-6 and IL-8, and Fibroblast-like synoviocyte invasiveness by regulating ERK and NF-kappaB activation in rheumatoid Fibroblast-like synoviocytes
21426659 The deficiency of RKIP expression is positively correlated with carcinogenesis and invasion metastasis of lung squamous cell carcinoma.
21332389 The frequent alteration in the YY1-RKIP balance might represent a marker of malignant progression and be exploited for therapeutic interventions in HCC.
21303975 RKIP/GSK3 axis is both a potential therapeutic target and a prognosis-based predictor of cancer progression.
21180766 The data suggest that modulation of the cell cycle checkpoints and motility by RKIP may be fundamental to its metastasis suppressive function in cancer and that RKIP role in a cell is more intricate and diverse than previously thought.
21080875 results strongly suggest that RKIP is a metastasis suppressor in pancreatic ductal adenocarcinoma
21074977 current data demonstrate no statistically significant correlation between the RKIP staining in primary cutaneous squamous cell carcinomas and their metastatic lesions
20869966 PEBP1 expression in pancreatic cancer was not associated with pTMN stage, differentiation grade and pathologic diagnosis.
20855151 Data show that a regulatory loop involving an opposing relationship between RKIP and the NF-kappaB pathway may control the level of MMP expression and cell invasion.
20853079 reduced RKIP mRNA levels and the elevated levels of B-RAF in pT1, grade III tumors vs. normal tissue, corroborate that these genes are involved in the pathogenesis of urinary bladder cancer.
20739083 PEBP1, prevalently down-regulated in hepatocellular carcinoma, was significantly associated with tumor invasive characteristics
20734161 RKIP expression is significantly reduced in anaplastic thyroid carcinoma as compared to other subtypes of thyroid carcinoma
20682295 Hippocampal cholinergic neurostimulating peptide (HCNP) precursor peptide expression patterns are altered in the hippocampus of transgenic mice compared with wild-type littermates.
20564197 suggested that RKIP was a potential biomarker for the radiosensitivity and prognosis of nasopharyngeal carcinoma (NPC), and its dysregulation might play an important role in the radioresistance of NPC
20533335 Six proteins were detected as up-regulated in higher grade astrocytomas and the most important finding was nucleophosmin (NPM) (p<0.05), whereas four proteins were down-regulated, among them raf kinase inhibitor protein (RKIP) (p<0.05).
20463977 This work defines the binding properties of RKIP ligands under near physiological conditions, establishing RKIP's affinity for hydrophobic ligands and the importance of bulky aliphatic chains for inhibiting its function.
20043910 Results show that RKIP has an overall inhibitory effect on the NF-kappaB transcriptional activities via IkappaB kinase complex
20028985 Bcr-Abl represses the expression of RKIP, continuously activates pERK1/2, and suppresses FoxM1 expression, resulting in proliferation of CML cells.
19957553 RKIP could inhibit metastasis, and also inhibit the growth of ovarian cancer cells.
19955695 the conserved signal transduction modulator RKIP was shown to enhance several aspects of neuronal differentiation via enhanced crosstalk from PKC to ERK-1/2 and enhancement of G-protein-coupled receptor signaling.
19779262 The expression of RKIP and E-cadherin in prostate cancer tissues was obviously lower than that in the benign prostatic hypertrophy tissues.
19705153 loss of RKIP expression could have an important role as prognostic marker in Gastrointestinal stromal tumours (GISTs).
19564817 The investigation of PEBP binding properties towards morphine and morphine analogs, is reported.
19551145 RKIP has a role in potentially sequestering toxic compounds, including locostatin, that may have deleterious effects on cells
19405953 This protein has been found differentially expressed in the Wernicke's Area from patients with schizophrenia.
19367706 RKIP is an invasion suppressor protein in nasopharyngeal carcinoma
19357705 loss of RKIP is a functional somatic event in carriers of C-RAF germline mutations, which contributes to the development of t-AML
19342899 Both BRAF and RKIP expression levels exhibit a decrease from normal skin tissue and actinic keratosis, going to squamous cell carcinoma.
19291429 Raf kinase inhibitor protein expression was highest in nonneoplastic gastric tissue, low in primary gastric cancer tissue, and lowest in metastatic gastric cancer tissue.
19228192 Elevated expression of RKIP in nitric-oxide-treated keratinocytes may contribute to the pathological & physiological features of NO-inhibited proliferation.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
19153603 Raf kinase inhibitory protein suppresses a metastasis signalling cascade involving LIN28 and let-7
19103740 RKIP uses a flexible pocket to integrate ligand binding- and phosphorylation-dependent interactions and to modulate the MAPK signaling pathway
19101508 These results demonstrating the absence of a disease-specific SNP in the HCNPpp promoter region suggest that the decrease in expression of this gene in late-onset AD patients can manifest from transcriptional or posttranscriptional changes in activity.
19096942 Non-phosphorylated RKIP is associated with nasopharyngeal carcinoma.
19034380 This protein has been found differentially expressed in the temporal lobe from patients with schizophrenia.
18567796 RKIP expression was inversely associated with the invasiveness of five ovarian cancer cell lines.
18483365 predictive and protective role of cytoplasmic RKIP expression in gastric adenocarcinoma of the intestinal subtype
18375747 RKIP loss by hypermethylation of its promoter could have a significant influence on colorectal cancer aneuploidy, which might explain its association with metastatic progression
18329792 RKIP could play an important role in the down-regulation of wild-type BRAF, serving thus as an endogenous inhibitor of the MAPK pathway in nasal polyps and their adjacent turbinate mucosa
18294816 the RKIP conserved pocket may constitute a novel phosphoamino-acid binding motif and is absolutely required for RKIP function
18172264 combined analysis of N stage, vascular invasion, and RKIP expression is highly predictive of distant metastasis in patients with mismatch repair--proficient colorectal cancer.
17952120 RKIP is a novel component of the Snail transcriptional regulatory network important for the progression and metastasis of cancer.
17911631 RKIP overexpression regulates tumor cell sensitivity to TRAIL via inhibition of Yin Yang 1, up-regulation of death receptor 5, and modulation of apoptotic pathways.
17179102 RKIP expression in primary colorectal cancers correlates with overall and disease-free survival, and can be useful for identifying early-stage colorectal cancer patients at risk of relapse
17145707 2',5'-oligoadenylate synthetase activation may occur in prostate cancer cells stimulated by cellular mRNAs for RKIP.
17097642 The Raf kinase inhibitory protein (RKIP) binds to Raf-1 interfering with binding of the MEK substrate and potentially also Raf-1 activation.
17030190 down-regulation of RKIP expression is a major factor in activation of the IGF-I/ERK/MAPK pathway during human hepatocarcinogenesis
17018026 Together these data identify PEBP as a potential in vivo calpain substrate and indicate that increased PEBP levels may contribute to impaired proteasome function.
16916643 These results indicate that RKIP regulates Aurora B kinase and the spindle checkpoint via the Raf-1/MEK/ERK cascade and demonstrate that small changes in the MAP kinase (MAPK) pathway can profoundly impact the fidelity of the cell cycle.
16865242 Raf kinase inhibitor protein is downregulated in hepatocellular carcinoma
16513087 data show for the first time that RKIP is upregulated during macrophage and dendritic cell differentiation.
16243812 Results suggest that in human breast cancer, RKIP is a metastasis suppressor gene whose expression must be down-regulated for metastases to develop.
15782137 Low expression of RKIP and its antagonistic action on B-Raf suggests that RKIP may play an important role in melanoma turmorgenesis
15327891 Review. The discovery, structure, function, and significance of RKIP in cancer are discussd.
14766752 RKIP may represent a novel effector of signal transduction pathways leading to apoptosis
14654844 After stimulation of G-protein-coupled receptors, RKIP dissociates from its known target, Raf-1, to associate with GRK-2 and block its activity [RKIP]

AA Sequence

MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTD      1 - 70
PDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSN     71 - 140
RSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK                           141 - 187
//

Text Mined References (196)

PMID Year Title
26859895 2016 Raf Kinase Inhibitor Protein Expression and Prognostic Value in Soft Tissue Sarcomas.
26823735 2015 Raf kinase inhibitor protein (RKIP) inhibits the cell migration and invasion in human glioma cell lines in vitro.
26716415 2016 Regulation of the epithelial to mesenchymal transition and metastasis by Raf kinase inhibitory protein-dependent Notch1 activity.
26617724 2015 Expression of RKIP, E-cadherin and NF-kB p65 in esophageal squamous cell carcinoma and their correlations.
26558823 2016 Human Intestinal Raf Kinase Inhibitor Protein (RKIP) Catalyzes Prasugrel as a Bioactivation Hydrolase.
26479924 2015 Cardiac RKIP induces a beneficial ?-adrenoceptor-dependent positive inotropy.
26308852 2015 RKIP Inhibits Local Breast Cancer Invasion by Antagonizing the Transcriptional Activation of MMP13.
26238785 2015 Metastasis Suppressors Regulate the Tumor Microenvironment by Blocking Recruitment of Prometastatic Tumor-Associated Macrophages.
26238523 2015 Effect of Raf kinase inhibitor protein expression on malignant biological behavior and progression of colorectal cancer.
26177829 2015 Role of Raf-kinase inhibitor protein in colorectal cancer and its regulation by hydroxycamptothecine.
26116914 2016 Raf kinase inhibitor protein mediated signaling inhibits invasion and metastasis of hepatocellular carcinoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25915430 2015 Reduction of RKIP expression promotes nasopharyngeal carcinoma invasion and metastasis by activating Stat3 signaling.
25819984 2015 IL-13 desensitizes ?2-adrenergic receptors in human airway epithelial cells through a 15-lipoxygenase/G protein receptor kinase 2 mechanism.
25819500 2015 Elevated Hippocampal Cholinergic Neurostimulating Peptide precursor protein (HCNP-pp) mRNA in the amygdala in major depression.
25700664 2015 Repeated sub-optimal photodynamic treatments with pheophorbide a induce an epithelial mesenchymal transition in prostate cancer cells via nitric oxide.
25597360 2014 Raf kinase inhibitory protein (RKIP): functional pleiotropy in the mammalian brain.
25597359 2014 Interactions of RKIP with inflammatory signaling pathways.
25597358 2014 RKIP: a governor of intracellular signaling.
25597357 2014 RKIP structure drives its function: a three-state model for regulation of RKIP.
25597356 2014 Role of Raf kinase inhibitor protein in Helicobacter pylori-mediated signaling in gastric cancer.
25597355 2014 Survey of Raf kinase inhibitor protein (RKIP) in multiple cancer types.
25597354 2014 Raf kinase inhibitory protein (RKIP) as a metastasis suppressor: regulation of signaling networks in cancer.
25597353 2014 RKIP-mediated chemo-immunosensitization of resistant cancer cells via disruption of the NF-?B/Snail/YY1/RKIP resistance-driver loop.
25597352 2014 Genetic and epigenetic control of RKIP transcription.
25597351 2014 Regulation of the MAPK pathway by raf kinase inhibitory protein.
25547433 2015 RKIP promotes cisplatin-induced gastric cancer cell death through NF-?B/Snail pathway.
25337233 2014 Correlation of RKIP, STAT3 and cyclin D1 expression in pathogenesis of gastric cancer.
25329396 2014 Genetic variants in RKIP are associated with clear cell renal cell carcinoma risk in a Chinese population.
25277181 2014 Common reduction of the Raf kinase inhibitory protein in clear cell renal cell carcinoma.
25172097 2014 RKIP inhibits gastric cancer cell survival and invasion by regulating the expression of HMGA2 and OPN.
25171481 2014 Association between raf kinase inhibitor protein loss and prognosis in cancers of the digestive system: a meta-analysis.
25128483 2014 miR-27a regulates cisplatin resistance and metastasis by targeting RKIP in human lung adenocarcinoma cells.
25017365 2014 RKIP suppresses gastric cancer cell proliferation and invasion and enhances apoptosis regulated by microRNA-224.
25015191 2014 Expression of RKIP in chronic myelogenous leukemia K562 cell and inhibits cell proliferation by regulating the ERK/MAPK pathway.
24909733 2014 TAOK3, a novel genome-wide association study locus associated with morphine requirement and postoperative pain in a retrospective pediatric day surgery population.
24863296 2014 Structural basis for RKIP binding with its substrate Raf1 kinase.
24763848 2014 Expression of Raf Kinase Inhibitor Protein (RKIP) is a predictor of uveal melanoma metastasis.
24658061 2014 Raf kinase inhibitor protein (RKIP) blocks signal transducer and activator of transcription 3 (STAT3) activation in breast and prostate cancer.
24655025 2014 Rituximab-mediated Raf kinase inhibitor protein induction modulates NF-?B in Sjögren syndrome.
24420151 2014 Clinical significance of RKIP mRNA expression in non-small cell lung cancer.
24395801 2014 Network of mutually repressive metastasis regulators can promote cell heterogeneity and metastatic transitions.
24392454 2013 Overexpression of RKIP inhibits cell invasion in glioma cell lines through upregulation of miR-98.
24335512 2014 Dihydroartemisinin induces apoptosis of cervical cancer cells via upregulation of RKIP and downregulation of bcl-2.
24330423 2013 Loss of Raf-1 kinase inhibitor protein (RKIP) is strongly associated with high-grade tumor budding and correlates with an aggressive phenotype in pancreatic ductal adenocarcinoma (PDAC).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24123286 2014 Raf kinase inhibitory protein role in the molecular subtyping of breast cancer.
24048798 2011 Additive effect on survival of Raf kinase inhibitor protein and signal transducer and activator of transcription 3 in high-grade glioma.
23991415 2013 A comparison of the biological features of prostate cancer with (PSA+, PSMA+) profile according to RKIP.
23975428 2014 RKIP and HMGA2 regulate breast tumor survival and metastasis through lysyl oxidase and syndecan-2.
23959677 2013 Phosphatidylethanolamine binding protein 1 in vacular endothelial cell autophagy and atherosclerosis.
23872143 2013 Solution structure and backbone dynamics of human Raf-1 kinase inhibitor protein.
23814485 2013 A new p53 target gene, RKIP, is essential for DNA damage-induced cellular senescence and suppression of ERK activation.
23674108 2013 Raf kinase inhibitor protein inhibits esophageal cancer cell invasion through downregulation of matrix metalloproteinase expression.
23636063 2013 Immunocytochemical detection of raf kinase inhibitor protein and human papillomavirus profiling of normal and abnormal cervical ThinPrep samples.
23632477 2013 Geographic analysis of RKIP expression and its clinical relevance in colorectal cancer.
23601922 2013 Raf kinase inhibitor protein (RKIP) and phospho-RKIP expression in melanomas.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23527098 2013 RKIP inhibition in cervical cancer is associated with higher tumor aggressive behavior and resistance to cisplatin therapy.
23460950 2013 Raf kinase inhibitor protein expression combined with peritoneal involvement and lymphovascular invasion predicts prognosis in Dukes' B colorectal cancer patients.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23376254 2013 Downregulation of phosphatidylethanolamine binding protein 1 associates with clinical risk factors in gastrointestinal stromal tumors, but not with activation of the RAF-1-MEK-ETV1 pathway.
23359513 2013 RKIP: much more than Raf kinase inhibitory protein.
23259789 2013 RKIP inhibits the malignant phenotypes of gastric cancer cells.
23254962 2013 Positive effect of high RKIP expression on reduced distant metastasis by chemotherapy when combined with radiotherapy in locoregionally advanced nasopharyngeal carcinoma: a prospective study.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23095933 2012 Transcriptional regulation of RKIP expression by androgen in prostate cells.
23075684 2012 [Expression and significance of Raf kinase inhibitory protein in lung cancer].
23066640 2012 Decreased expression and aberrant methylation of Raf kinase inhibitory protein gene in esophageal squamous cell carcinoma.
23066033 2012 Raf kinase inhibitor RKIP inhibits MDA-9/syntenin-mediated metastasis in melanoma.
22983529 2013 Aberrant methylation and loss expression of RKIP is associated with tumor progression and poor prognosis in gastric cardia adenocarcinoma.
22935977 2012 Reduced expression of Raf-1 kinase inhibitory protein in renal cell carcinoma: a significant prognostic marker.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
22899242 2013 RKIP and 14-3-3? exert an opposite effect on human gastric cancer cells SGC7901 by regulating the ERK/MAPK pathway differently.
22875620 2012 Mutations inDNMT3A and loss of RKIP are independent events in acute monocytic leukemia.
22855160 2012 Reduced expression of Raf kinase inhibitor protein correlates with poor prognosis in pancreatic cancer.
22833545 2012 Secretome analysis of ionizing radiation-induced senescent cancer cells reveals that secreted RKIP plays a critical role in neighboring cell migration.
22809510 2012 MicroRNA-224 targets RKIP to control cell invasion and expression of metastasis genes in human breast cancer cells.
22692503 2013 Expression and significance of RKIP and E-cadherin in lung squamous cell carcinoma.
22684368 2012 Raf kinase inhibitor protein (RKIP) in cancer.
22662230 2012 Regulation of RKIP function by Helicobacter pylori in gastric cancer.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22605662 2013 Prospective study of prognostic value of Raf kinase inhibitory protein and pretreatment plasma Epstein-Barr virus DNA for distant metastasis in locoregionally advanced nasopharyngeal carcinoma.
22562283 2012 Reduced Raf-1 kinase inhibitor protein expression predicts less favorable outcomes in patients with hepatic colorectal metastasis.
22558375 2012 Ligand binding study of human PEBP1/RKIP: interaction with nucleotides and Raf-1 peptides evidenced by NMR and mass spectrometry.
22505648 2012 Polycomb protein EZH2 regulates tumor invasion via the transcriptional repression of the metastasis suppressor RKIP in breast and prostate cancer.
22492043 2012 Regulation of MAPK/ERK signaling and photic entrainment of the suprachiasmatic nucleus circadian clock by Raf kinase inhibitor protein.
22463874 2012 Prognostic value of RKIP and p-ERK in gastric cancer.
22460832 2012 RAF-kinase inhibitor protein (RKIP) downregulation in esophageal cancer and its metastases.
22388727 2012 Frequent loss of RAF kinase inhibitor protein expression in acute myeloid leukemia.
22373584 2012 The effects of RKIP gene expression on the biological characteristics of human triple-negative breast cancer cells in vitro.
22295570 RKIp inhibits the migration and invasion of human prostate cancer PC-3M cells through regulation of extracellular matrix.
22292035 2012 Downregulation of RKIP is associated with poor outcome and malignant progression in gliomas.
22279539 2012 A new model for raf kinase inhibitory protein induced chemotherapeutic resistance.
22248055 2011 The novel role of Yin Yang 1 in the regulation of epithelial to mesenchymal transition in cancer via the dysregulated NF-?B/Snail/YY1/RKIP/PTEN Circuitry.
22246605 2012 RKIP expression associated with gastric cancer cell invasion and metastasis.
22102006 2012 Prognostic value of raf kinase inhibitor protein in esophageal squamous cell carcinoma.
22031589 2012 Loss of RKIP expression during the carcinogenic evolution of endometrial cancer.
21875465 2011 [Expression of Raf kinase inhibitor protein and its significance in invasion and metastasis of hepatocellular carcinoma].
21873975 2011 Signalling pathway for RKIP and Let-7 regulates and predicts metastatic breast cancer.
21831839 2011 15-Lipoxygenase 1 interacts with phosphatidylethanolamine-binding protein to regulate MAPK signaling in human airway epithelial cells.
21732351 2012 Possible role of RKIP in cytotrophoblast migration: immunohistochemical and in vitro studies.
21689459 2011 Expression of phosphorylated raf kinase inhibitor protein (pRKIP) is a predictor of lung cancer survival.
21685394 2011 Accumulation of the Raf-1 kinase inhibitory protein (Rkip) is associated with Cep290-mediated photoreceptor degeneration in ciliopathies.
21672326 2011 Immunohistochemical detection of Raf kinase inhibitor protein in normal cervical tissue and cervical cancer tissue.
21664646 2011 Systematic analysis of proteins from different signaling pathways in the tumor center and the invasive front of colorectal cancer.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21617351 2011 RKIP downregulation induces the HBx-mediated Raf-1 mitochondrial translocation.
21556737 2012 The role of Raf kinase inhibitor protein in rheumatoid fibroblast-like synoviocytes invasiveness and cytokine and matrix metalloproteinase expression.
21426659 2011 [The expression and significance of RKIP in lung squamous cell carcinoma tissues].
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21332389 2011 Frequent alteration of the Yin Yang 1/Raf-1 kinase inhibitory protein ratio in hepatocellular carcinoma.
21303975 2011 Raf kinase inhibitor protein RKIP enhances signaling by glycogen synthase kinase-3?.
21269460 2011 Initial characterization of the human central proteome.
21180766 2011 RAF kinase inhibitory protein (RKIP) modulates cell cycle kinetics and motility.
21080875 2010 Loss of Raf-1 kinase inhibitory protein in pancreatic ductal adenocarcinoma.
21074977 2010 Raf kinase inhibitor protein expression correlates with differentiation but not with ERK phosphorylation in cutaneous squamous cell carcinoma.
20869966 2010 Development and evaluation of monoclonal antibodies against phosphatidylethanolamine binding protein 1 in pancreatic cancer patients.
20855151 2010 Raf kinase inhibitor protein suppresses nuclear factor-?B-dependent cancer cell invasion through negative regulation of matrix metalloproteinase expression.
20853079 2011 Implication of RAF and RKIP genes in urinary bladder cancer.
20739083 2010 PEBP1 downregulation is associated to poor prognosis in HCC related to hepatitis B infection.
20734161 2010 Raf-1 kinase inhibitory protein expression in thyroid carcinomas.
20682295 2010 Suppressed phosphorylation of collapsin response mediator protein-2 in the hippocampus of HCNP precursor transgenic mice.
20564197 2010 Raf kinase inhibitor protein correlates with sensitivity of nasopharyngeal carcinoma to radiotherapy.
20533335 2010 Proteomic analysis of low- to high-grade astrocytomas reveals an alteration of the expression level of raf kinase inhibitor protein and nucleophosmin.
20463977 2010 Characterization of the Raf kinase inhibitory protein (RKIP) binding pocket: NMR-based screening identifies small-molecule ligands.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20043910 2010 RKIP inhibits NF-kappaB in cancer cells by regulating upstream signaling components of the IkappaB kinase complex.
20028985 2010 Reduction of Raf kinase inhibitor protein expression by Bcr-Abl contributes to chronic myelogenous leukemia proliferation.
19957553 2009 [Relationship between raf kinase inhibitor protein and metastasis of ovarian carcinoma].
19955695 2010 Raf kinase inhibitor protein enhances neuronal differentiation in human SH-SY5Y cells.
19779262 2009 [Expression of Raf kinase inhibitor protein and E-cadherin in prostate cancer tissues].
19705153 2009 Loss of RKIP expression is associated with poor survival in GISTs.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19564817 2009 Characterization of human and bovine phosphatidylethanolamine-binding protein (PEBP/RKIP) interactions with morphine and morphine-glucuronides determined by noncovalent mass spectrometry.
19551145 2009 Raf Kinase Inhibitory Protein protects cells against locostatin-mediated inhibition of migration.
19405953 2009 Proteome analysis of schizophrenia patients Wernicke's area reveals an energy metabolism dysregulation.
19367706 2008 Identification of RKIP as an invasion suppressor protein in nasopharyngeal carcinoma by proteomic analysis.
19357705 2009 Loss of RAF kinase inhibitor protein is a somatic event in the pathogenesis of therapy-related acute myeloid leukemias with C-RAF germline mutations.
19342899 2009 BRAF and RKIP are significantly decreased in cutaneous squamous cell carcinoma.
19291429 2010 Immunohistochemical detection of the Raf kinase inhibitor protein in nonneoplastic gastric tissue and gastric cancer tissue.
19228192 2009 Nitric oxide enhances expression of raf kinase inhibitor protein in keratinocytes.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19153603 2009 Raf kinase inhibitory protein suppresses a metastasis signalling cascade involving LIN28 and let-7.
19103740 2009 Raf kinase inhibitory protein function is regulated via a flexible pocket and novel phosphorylation-dependent mechanism.
19101508 2009 Analysis of DNA variations in promoter region of HCNP gene with Alzheimer's disease.
19096942 2009 Identification of RKIP as a differentially tyrosine-phosphorylated protein in nasopharyngeal carcinoma and normal nasopharyngeal epithelial tissues by phosphoproteomic approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19034380 2009 Alterations in oligodendrocyte proteins, calcium homeostasis and new potential markers in schizophrenia anterior temporal lobe are revealed by shotgun proteome analysis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18567796 2008 Effects of raf kinase inhibitor protein expression on metastasis and progression of human epithelial ovarian cancer.
18483365 2008 Inverse association between Raf Kinase Inhibitory Protein and signal transducers and activators of transcription 3 expression in gastric adenocarcinoma patients: implications for clinical outcome.
18375747 2008 Raf kinase inhibitor protein: mechanism of loss of expression and association with genomic instability.
18329792 2008 RKIP and BRAF aberrations in human nasal polyps and the adjacent turbinate mucosae.
18294816 2008 The RKIP (Raf-1 Kinase Inhibitor Protein) conserved pocket binds to the phosphorylated N-region of Raf-1 and inhibits the Raf-1-mediated activated phosphorylation of MEK.
18172264 2008 Node-negative colorectal cancer at high risk of distant metastasis identified by combined analysis of lymph node status, vascular invasion, and Raf-1 kinase inhibitor protein expression.
17952120 2008 Snail is a repressor of RKIP transcription in metastatic prostate cancer cells.
17911631 2007 Regulation of tumor cell sensitivity to TRAIL-induced apoptosis by the metastatic suppressor Raf kinase inhibitor protein via Yin Yang 1 inhibition and death receptor 5 up-regulation.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17179102 2006 Raf kinase inhibitor protein expression in a survival analysis of colorectal cancer patients.
17145707 2006 Selection and cloning of poly(rC)-binding protein 2 and Raf kinase inhibitor protein RNA activators of 2',5'-oligoadenylate synthetase from prostate cancer cells.
17097642 2006 Regulation of RKIP binding to the N-region of the Raf-1 kinase.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17030190 2006 Loss of Raf kinase inhibitor protein promotes cell proliferation and migration of human hepatoma cells.
17018026 2006 Identification and characterization of PEBP as a calpain substrate.
16916643 2006 Raf kinase inhibitory protein regulates aurora B kinase and the spindle checkpoint.
16865242 2006 Raf kinase inhibitor protein is downregulated in hepatocellular carcinoma.
16513087 2006 Induction of Raf kinase inhibitor protein contributes to macrophage differentiation.
16243812 2005 Reduction of Raf-1 kinase inhibitor protein expression correlates with breast cancer metastasis.
15782137 2005 RKIP downregulates B-Raf kinase activity in melanoma cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15327891 2004 Raf-1 kinase inhibitor protein: structure, function, regulation of cell signaling, and pivotal role in apoptosis.
15001550 2004 Transcriptional cofactors exhibit differential preference toward peroxisome proliferator-activated receptors alpha and delta in uterine cells.
14766752 2004 RKIP sensitizes prostate and breast cancer cells to drug-induced apoptosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14654844 2003 Protein kinase C switches the Raf kinase inhibitor from Raf-1 to GRK-2.
12551925 2003 Activation of Raf-1 signaling by protein kinase C through a mechanism involving Raf kinase inhibitory protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
11853019 2002 Decreased expression of hippocampal cholinergic neurostimulating peptide precursor protein mRNA in the hippocampus in Alzheimer disease.
11585904 2001 Raf kinase inhibitor protein interacts with NF-kappaB-inducing kinase and TAK1 and inhibits NF-kappaB activation.
11034991 2001 The phosphatidylethanolamine-binding protein is the prototype of a novel family of serine protease inhibitors.
10757792 2000 Mechanism of suppression of the Raf/MEK/extracellular signal-regulated kinase pathway by the raf kinase inhibitor protein.
10622376 2000 Hippocampal cholinergic neurostimulating peptides (HCNP).
10490027 1999 Suppression of Raf-1 kinase activity and MAP kinase signalling by RKIP.
9782050 1998 Function from structure? The crystal structure of human phosphatidylethanolamine-binding protein suggests a role in membrane signal transduction.
8738137 1996 Sequence analysis and immunolocalisation of phosphatidylethanolamine binding protein (PBP) in human brain tissue.
8144042 1994 A human cDNA sequence homologue of bovine phosphatidylethanolamine-binding protein.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7807553 1994 Amino acid sequence of the Homo sapiens brain 21-23-kDa protein (neuropolypeptide h3), comparison with its counterparts from Rattus norvegicus and Bos taurus species, and expression of its mRNA in different tissues.
7641877 1995 From structure to function: possible biological roles of a new widespread protein family binding hydrophobic ligands and displaying a nucleotide binding site.
7637590 1995 Sequence homology of rat and human HCNP precursor proteins, bovine phosphatidylethanolamine-binding protein and rat 23-kDa protein associated with the opioid-binding protein.
1286669 1992 Human liver protein map: a reference database established by microsequencing and gel comparison.