Property Summary

NCBI Gene PubMed Count 21
PubMed Score 15.75
PubTator Score 20.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active Crohn's disease 1.143 6.0e-03
acute quadriplegic myopathy -1.253 4.3e-03
adrenocortical carcinoma -2.914 5.3e-04
aldosterone-producing adenoma -1.355 1.8e-02
Atopic dermatitis -1.300 4.0e-04
Breast cancer -1.400 4.8e-04
breast carcinoma -1.200 8.6e-21
colon cancer -1.200 3.5e-02
ductal carcinoma in situ -1.500 2.7e-03
group 3 medulloblastoma -1.800 4.3e-02
head and neck cancer -1.600 1.9e-02
intraductal papillary-mucinous adenoma (... -2.400 4.5e-04
intraductal papillary-mucinous neoplasm ... -2.700 1.9e-03
invasive ductal carcinoma -3.200 4.7e-04
lung adenocarcinoma -1.100 2.6e-07
lung cancer -2.300 1.8e-04
malignant mesothelioma -3.700 8.4e-08
medulloblastoma, large-cell -3.400 1.4e-03
ovarian cancer -2.500 6.6e-05
pituitary cancer -1.700 4.1e-04
psoriasis -1.300 6.1e-05

Gene RIF (5)

AA Sequence

MGFELDRFDGDVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCPARCRGRLSAKELNHVLP      1 - 70
LKRLILKLDIKCAYATRGCGRVVKLQQLPEHLERCDFAPARCRHAGCGQVLLRRDVEAHMRDACDARPVG     71 - 140
RCQEGCGLPLTHGEQRAGGHCCARALRAHNGALQARLGALHKALKKEALRAGKREKSLVAQLAAAQLELQ    141 - 210
MTALRYQKKFTEYSARLDSLSRCVAAPPGGKGEETKSLTLVLHRDSGSLGFNIIGGRPSVDNHDGSSSEG    211 - 280
IFVSKIVDSGPAAKEGGLQIHDRIIEVNGRDLSRATHDQAVEAFKTAKEPIVVQVLRRTPRTKMFTPPSE    281 - 350
SQLVDTGTQTDITFEHIMALTKMSSPSPPVLDPYLLPEEHPSAHEYYDPNDYIGDIHQEMDREELELEEV    351 - 420
DLYRMNSQDKLGLTVCYRTDDEDDIGIYISEIDPNSIAAKDGRIREGDRIIQINGIEVQNREEAVALLTS    421 - 490
EENKNFSLLIARPELQLDEGWMDDDRNDFLDDLHMDMLEEQHHQAMQFTASVLQQKKHDEDGGTTDTATI    491 - 560
LSNQHEKDSGVGRTDESTRNDESSEQENNGDDATASSNPLAGQRKLTCSQDTLGSGDLPFSNESFISADC    561 - 630
TDADYLGIPVDECERFRELLELKCQVKSATPYGLYYPSGPLDAGKSDPESVDKELELLNEELRSIELECL    631 - 700
SIVRAHKMQQLKEQYRESWMLHNSGFRNYNTSIDVRRHELSDITELPEKSDKDSSSAYNTGESCRSTPLT    701 - 770
LEISPDNSLRRAAEGISCPSSEGAVGTTEAYGPASKNLLSITEDPEVGTPTYSPSLKELDPNQPLESKER    771 - 840
RASDGSRSPTPSQKLGSAYLPSYHHSPYKHAHIPAHAQHYQSYMQLIQQKSAVEYAQSQMSLVSMCKDLS    841 - 910
SPTPSEPRMEWKVKIRSDGTRYITKRPVRDRLLRERALKIREERSGMTTDDDAVSEMKMGRYWSKEERKQ    911 - 980
HLVKAKEQRRRREFMMQSRLDCLKEQQAADDRKEMNILELSHKKMMKKRNKKIFDNWMTIQELLTHGTKS    981 - 1050
PDGTRVYNSFLSVTTV                                                         1051 - 1066
//

Text Mined References (22)

PMID Year Title