Property Summary

NCBI Gene PubMed Count 21
PubMed Score 14.70
PubTator Score 20.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma -3.700 8.4e-08
psoriasis -1.300 6.1e-05
medulloblastoma, large-cell -3.400 1.4e-03
acute quadriplegic myopathy -1.253 4.3e-03
Atopic dermatitis -1.300 4.0e-04
adrenocortical carcinoma -2.914 5.3e-04
intraductal papillary-mucinous adenoma (... -2.400 4.5e-04
intraductal papillary-mucinous neoplasm ... -2.700 1.9e-03
colon cancer -1.800 3.8e-03
lung cancer -2.300 1.8e-04
active Crohn's disease 1.143 6.0e-03
group 4 medulloblastoma -4.200 5.8e-06
aldosterone-producing adenoma -1.355 1.8e-02
lung adenocarcinoma -1.100 2.6e-07
breast carcinoma -1.200 8.6e-21
Breast cancer -1.400 4.8e-04
ductal carcinoma in situ -1.500 2.7e-03
invasive ductal carcinoma -3.200 4.7e-04
ovarian cancer -2.500 6.6e-05
pituitary cancer -1.700 4.1e-04
head and neck cancer -1.600 1.9e-02

Gene RIF (5)

PMID Text
25355882 Authors show that HPV-16 and HPV-18 E6 can target PDZRN3 in a PDZ- and proteasome-dependent manner and provide a connection between the papillomavirus life cycle and differentiation-related STAT signaling.
22609016 a novel partner of Kidins220/ARMS
20668165 These results indicate that PDZRN3 plays an important role in negative feedback control of BMP-2-induced osteoblast differentiation in C2C12 cells through inhibition of Wnt3a-beta-catenin signaling.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20306291 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MGFELDRFDGDVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCPARCRGRLSAKELNHVLP      1 - 70
LKRLILKLDIKCAYATRGCGRVVKLQQLPEHLERCDFAPARCRHAGCGQVLLRRDVEAHMRDACDARPVG     71 - 140
RCQEGCGLPLTHGEQRAGGHCCARALRAHNGALQARLGALHKALKKEALRAGKREKSLVAQLAAAQLELQ    141 - 210
MTALRYQKKFTEYSARLDSLSRCVAAPPGGKGEETKSLTLVLHRDSGSLGFNIIGGRPSVDNHDGSSSEG    211 - 280
IFVSKIVDSGPAAKEGGLQIHDRIIEVNGRDLSRATHDQAVEAFKTAKEPIVVQVLRRTPRTKMFTPPSE    281 - 350
SQLVDTGTQTDITFEHIMALTKMSSPSPPVLDPYLLPEEHPSAHEYYDPNDYIGDIHQEMDREELELEEV    351 - 420
DLYRMNSQDKLGLTVCYRTDDEDDIGIYISEIDPNSIAAKDGRIREGDRIIQINGIEVQNREEAVALLTS    421 - 490
EENKNFSLLIARPELQLDEGWMDDDRNDFLDDLHMDMLEEQHHQAMQFTASVLQQKKHDEDGGTTDTATI    491 - 560
LSNQHEKDSGVGRTDESTRNDESSEQENNGDDATASSNPLAGQRKLTCSQDTLGSGDLPFSNESFISADC    561 - 630
TDADYLGIPVDECERFRELLELKCQVKSATPYGLYYPSGPLDAGKSDPESVDKELELLNEELRSIELECL    631 - 700
SIVRAHKMQQLKEQYRESWMLHNSGFRNYNTSIDVRRHELSDITELPEKSDKDSSSAYNTGESCRSTPLT    701 - 770
LEISPDNSLRRAAEGISCPSSEGAVGTTEAYGPASKNLLSITEDPEVGTPTYSPSLKELDPNQPLESKER    771 - 840
RASDGSRSPTPSQKLGSAYLPSYHHSPYKHAHIPAHAQHYQSYMQLIQQKSAVEYAQSQMSLVSMCKDLS    841 - 910
SPTPSEPRMEWKVKIRSDGTRYITKRPVRDRLLRERALKIREERSGMTTDDDAVSEMKMGRYWSKEERKQ    911 - 980
HLVKAKEQRRRREFMMQSRLDCLKEQQAADDRKEMNILELSHKKMMKKRNKKIFDNWMTIQELLTHGTKS    981 - 1050
PDGTRVYNSFLSVTTV                                                         1051 - 1066
//

Text Mined References (22)

PMID Year Title
25355882 2015 PDZRN3/LNX3 is a novel target of human papillomavirus type 16 (HPV-16) and HPV-18 E6.
25198863 2014 The ubiquitin ligase PDZRN3 is required for vascular morphogenesis through Wnt/planar cell polarity signalling.
23576576 2013 Regulation of adipocyte differentiation of 3T3-L1 cells by PDZRN3.
23166209 2012 Impact of ancestry and common genetic variants on QT interval in African Americans.
22664479 2013 A genome-wide association study for irinotecan-related severe toxicities in patients with advanced non-small-cell lung cancer.
22609016 2012 Kidins220/ARMS interacts with Pdzrn3, a protein containing multiple binding domains.
22290856 2012 3p interstitial deletion: novel case report and review.
21827680 2011 Molecular evolution of the LNX gene family.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
20668165 2010 PDZRN3 negatively regulates BMP-2-induced osteoblast differentiation through inhibition of Wnt signaling.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20306291 2010 A three-stage genome-wide association study of general cognitive ability: hunting the small effects.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17118964 2006 PDZRN3 (LNX3, SEMCAP3) is required for the differentiation of C2C12 myoblasts into myotubes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15458844 2004 The complexity of PDZ domain-mediated interactions at glutamatergic synapses: a case study on neuroligin.
15305371 2004 Gene expression profiles in primary ovarian serous papillary tumors and normal ovarian epithelium: identification of candidate molecular markers for ovarian cancer diagnosis and therapy.
15188402 2004 Proteins associated with type II bone morphogenetic protein receptor (BMPR-II) and identified by two-dimensional gel electrophoresis and mass spectrometry.
15010864 2004 Identification and characterization of PDZRN3 and PDZRN4 genes in silico.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.