Property Summary

NCBI Gene PubMed Count 26
PubMed Score 155.75
PubTator Score 87.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer 1.400 2.9e-03
pancreatic cancer 1.800 2.8e-04
psoriasis 2.600 2.1e-10
osteosarcoma -4.302 9.3e-05
intraductal papillary-mucinous neoplasm ... 1.300 1.9e-02
active Crohn's disease 1.575 9.5e-03
ulcerative colitis 3.500 1.2e-05
pancreatic carcinoma 1.400 7.4e-03
lung adenocarcinoma 1.200 2.1e-02
nasopharyngeal carcinoma -1.300 3.4e-03
Endometriosis -1.245 1.2e-02
Breast cancer -1.100 2.0e-02
chronic rhinosinusitis 1.670 2.1e-02
head and neck cancer and chronic obstruc... 1.500 3.4e-03
non-small cell lung cancer 1.200 3.2e-02

Synonym

Accession Q13113 Q6ICT9 Q96EI1
Symbols DD96
SPAP
MAP17

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (12)

PMID Text
25837675 Data show that bortezomib induces a prosurvival response through cytoprotective autophagy and nuclear factor kappa B (NFkappaB) nuclear translocation, which is repressed by high levels of membrane-associated protein 17 (MAP17).
25788275 In this study we found that the levels of MAP17 were related to clinical findings and survival in a cohort of 58 patients with larynx cancer
23418532 Results suggest that the use of MAP17 and SGLT1 markers may identify patients who are likely to exhibit a better response to treatments that boost oxidative stress in other cancer types.
22266858 MAP17 is overexpressed in late-stage breast tumors, in which oncogenic activity relies on p38 insensitivity to induce intracellular ROS.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19601982 The Th cell cytokine-induced up-regulation of MAP17 expression may be linked to the down-regulation of filaggrin in normal epidermal keratinocytes, which may be associated with abnormal epidermal differentiation observed in the dermatological diseases.
18303113 point mutation observed by transcriptome sequencing of malignant pleural mesothelioma tumors
17675338 MAP17 protein activates AKT through ROS and this is determinant to confer resistance to Myc-induced apoptosis in the absence of serum.
17548903 Tumorigenic capability of MAP17 through a connection between sodium-coupled co-transporters and reactive oxygen species.
17426052 Independent activation of MAP17 promoter can be driven by oncogenes and might explain the common overexpression of MAP17 in human carcinomas.
17230460 Large scale genetic screening identifies MAP17 as protein bypassing TNF-alpha-induced growth arrest.

AA Sequence

MSALSLLILGLLTAVPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEEPEPAHMILTVGN      1 - 70
KADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRSTPM                               71 - 114
//

Text Mined References (26)

PMID Year Title
25837675 2015 MAP17 (PDZKIP1) Expression Determines Sensitivity to the Proteasomal Inhibitor Bortezomib by Preventing Cytoprotective Autophagy and NF?B Activation in Breast Cancer.
25788275 2015 MAP17 (PDZKIP1) as a novel prognostic biomarker for laryngeal cancer.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
23418532 2013 MAP17 and SGLT1 protein expression levels as prognostic markers for cervical tumor patient survival.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22266858 2012 p38? limits the contribution of MAP17 to cancer progression in breast tumors.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19601982 2010 MAP17 is associated with the T-helper cell cytokine-induced down-regulation of filaggrin transcription in human keratinocytes.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18303113 2008 Transcriptome sequencing of malignant pleural mesothelioma tumors.
17675338 2007 MAP17 inhibits Myc-induced apoptosis through PI3K/AKT pathway activation.
17548903 2007 MAP17 enhances the malignant behavior of tumor cells through ROS increase.
17426052 2007 MAP17 overexpression is a common characteristic of carcinomas.
17230460 2007 Large scale genetic screen identifies MAP17 as protein bypassing TNF-induced growth arrest.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14531806 2003 PDZK1: I. a major scaffolder in brush borders of proximal tubular cells.
12837682 2003 Interactions of MAP17 with the NaPi-IIa/PDZK1 protein complex in renal proximal tubular cells.
12754212 2003 Identification of small PDZK1-associated protein, DD96/MAP17, as a regulator of PDZK1 and plasma high density lipoprotein levels.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11997341 2002 Transcriptional regulation of the stem cell leukemia gene (SCL)--comparative analysis of five vertebrate SCL loci.
9815914 1995 Identification of a novel gene, selectively up-regulated in human carcinomas, using the differential display technique.
9461128 1998 Identification and partial characterization of PDZK1: a novel protein containing PDZ interaction domains.
8701988 1996 Identification and partial characterization of a novel membrane-associated protein (MAP17) up-regulated in human carcinomas and modulating cell replication and tumor growth.