Property Summary

NCBI Gene PubMed Count 75
PubMed Score 63.20
PubTator Score 55.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6685 5.7e-36
Disease Target Count Z-score Confidence
Gout 93 3.973 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.700 5.7e-36

Synonym

Accession Q5T2W1 B4DPB9 E7EU02 O60450 Q5T5P6 Q9BQ41 NHERF-3
Symbols CAP70
CLAMP
PDZD1
NHERF3
NHERF-3

Gene

PDB

3TMH   2EEI   2EEJ   2VSP   4Q2P  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (44)

PMID Text
26183824 PARP regulates estradiol-mediated cell growth by controlling the ER/IGF-1R/PDZK1 axis.
25562428 PDZK1, negatively regulates 5-HT2AR endocytosis and has no effect upon 5-HT2AR-mediated ERK1/2 phosphorylation.
25526531 IRF3 activation by innate antiviral signaling represses TGF-beta-induced growth inhibition, gene regulation and epithelial-mesenchymal transition, and the generation of Treg effector lymphocytes from naive CD4(+) lymphocytes.
25362723 PDZKA1 adaptor protein gene of urate transporters, is not associated with gout.
25348485 Described is a structure of D-AKAP2 in complex with two interacting partners and the exact mechanism by which a segment that on its own is disordered presents an alpha-helix to PKA and a beta-strand to PDZK1.
25271043 Inflammation-induced loss of PDZK1 expression may contribute to the NHE3 dysfunction observed in the inflamed intestine.
24869908 Correlation between PDZK1, Cdc37, Akt and breast cancer malignancy: the role of PDZK1 in cell growth through Akt stabilization by increasing and interacting with Cdc37
24728453 PDZK1 and NHERF1 regulate the transport function of OATP1A2 by modulating protein internalization via a clathrin-dependent pathway and by enhancing protein stability.
24436471 NHERF3 is a key regulator of organic transport in the kidney, particularly MRP4-mediated clearance of drug molecules.
23821363 These results clarify the relationship between ER-alpha and PDZK1, propose a direct relationship between PDZK1 and IGF1R, and identify a novel oncogenic activity for PDZK1 in breast cancer.
23547718 Antibody screening revealed 3 candidate prognostic markers in breast cancer: the Anillin (ANLN); PDZ-Binding Kinase (PBK); and, PDZ-Domain Containing 1 (PDZK1).
22696060 Upregulation of PDZK1 could have an important role in the development of melasma in connection with estrogen through NHE, CFTR, and SLC26A3.
22528496 PDZ domain-containing 1 (PDZK1) protein regulates phospholipase C-beta3 (PLC-beta3)-specific activation of somatostatin by forming a ternary complex with PLC-beta3 and somatostatin receptors.
21653824 Human prostacyclin receptor interacts with the PDZ adapter protein PDZK1; this interaction plays important role in endothelial cell migration and angiogenesis.
21183661 Although PDZK1 binding is required for optimal cell surface expression of oatp1a1, phosphorylation provides a mechanism for fast regulation of the distribution of oatp1a1 between the cell surface and intracellular vesicular pools.
20949066 The SR-BI partner PDZK1 facilitates hepatitis C virus entry.
20884846 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20855565 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20237154 Data show that PDZK1/EBP50/ezrin form a regulated ternary complex in vitro and in vivo.
20162743 Observational study of gene-disease association. (HuGE Navigator)
20162742 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19890391 Observational study of gene-disease association. (HuGE Navigator)
19861489 Observational study of gene-disease association. (HuGE Navigator)
19535329 NHERF3 colocalizes and directly binds NHE3 at the plasma membrane under basal conditions.
19503597 Meta-analysis of gene-disease association. (HuGE Navigator)
19447883 In HEK cells, which express little PDZK1, additional transfection of PDZK1 was required for UTP to inhibit DRA.
19321583 findings suggest that PDZ domain containing 1 (PDZK1)_i33968C > T genetic variants may be associated with a higher risk of exhibiting metabolic syndrome
19321583 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19173579 The tail of PDZK1 interacts with the PDZ domains of EBP50, and this interaction is negatively regulated by the intramolecular association of the tail of PDZK1 with its first PDZ domain.
19091402 While the presence of forskolin results in an increase in OCTN2 protein expression, the increase in uptake capacity may be compensated by the decreased expression of PDZK1, NHERF1 or NHERF2.
18955051 Endogenous PPARalpha regulates PDZK1 expression.
18403724 Established a mouse model to study human reverse cholesterol transport by expressing CLA-1, human PDZK1, and human apoA-I gene.
17990980 Pdzk1 plays a specific role in stabilizing Muc17 in the apical membrane of small intestinal enterocytes.
17602283 The interaction of PDZ proteins with hOAT4 may be cell-specific. In placenta, a different set of interacting proteins from PDZK1 and NHERF1 may be required to modulate hOAT4 activity.
17507652 The mechanisms by which the C-terminal four amino acids of inducible nitric oxide synthase (NOS2) interact with proteins that contain PDZ (PSD-95/DLG/ZO-1) domains resulting in the translocation of NOS2 to the cellular apical domain, is analyzed.
16738539 PEPT2-PDZK1 interaction thus plays a physiologically important role in both oligopeptide handling as well as peptide-like drug transport in the human kidney
16012170 intracellular sorting of the somatostatin receptor subtype 5 is regulated by interactions with PDZ domain proteins PIST/GOPC and PDZK1
15994332 oligomerization of Oatp1a1 with PDZK1 is critical for its proper subcellular localization and function
15523054 Double transfection of OCTN2 with PDZK1 intestinal and kidney-enriched PDZ protein))stimulated the uptake by OCTN2 of its endogenous substrate carnitine.
15494376 We have examined the ability of Bcr to interact with other epithelial PDZ proteins and found specific binding to both the apical PDZK1 protein and the Golgi-localized Mint3
15304510 PDZK1 plays a role in regulating the functional activity of URAT1-mediated urate transport in the apical membrane of renal proximal tubules.
15215163 Overexpression of PDZK1 is associated with a drug-resistance phenotype in multiple myeloma.

AA Sequence

MTSTFNPRECKLSKQEGQNYGFFLRIEKDTEGHLVRVVEKCSPAEKAGLQDGDRVLRINGVFVDKEEHMQ      1 - 70
VVDLVRKSGNSVTLLVLDGDSYEKAVKTRVDLKELGQSQKEQGLSDNILSPVMNGGVQTWTQPRLCYLVK     71 - 140
EGGSYGFSLKTVQGKKGVYMTDITPQGVAMRAGVLADDHLIEVNGENVEDASHEEVVEKVKKSGSRVMFL    141 - 210
LVDKETDKRHVEQKIQFKRETASLKLLPHQPRIVEMKKGSNGYGFYLRAGSEQKGQIIKDIDSGSPAEEA    211 - 280
GLKNNDLVVAVNGESVETLDHDSVVEMIRKGGDQTSLLVVDKETDNMYRLAHFSPFLYYQSQELPNGSVK    281 - 350
EAPAPTPTSLEVSSPPDTTEEVDHKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDE    351 - 420
DVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLLVCGKKAYDYFQAKKIPIVSSLADPLDTPPDSKEGIVV    421 - 490
ESNHDSHMAKERAHSTASHSSSNSEDTEM                                             491 - 519
//

Text Mined References (76)

PMID Year Title
26183824 2015 Poly(ADP-ribose) polymerase as a novel regulator of 17?-estradiol-induced cell growth through a control of the estrogen receptor/IGF-1 receptor/PDZK1 axis.
25562428 2015 PDZK1/NHERF3 differentially regulates corticotropin-releasing factor receptor 1 and serotonin 2A receptor signaling and endocytosis.
25526531 2014 Innate antiviral host defense attenuates TGF-? function through IRF3-mediated suppression of Smad signaling.
25362723 2014 Common variant of PDZK1, adaptor protein gene of urate transporters, is not associated with gout.
25348485 2015 D-AKAP2:PKA RII:PDZK1 ternary complex structure: insights from the nucleation of a polyvalent scaffold.
25271043 2015 Evidence for a causal link between adaptor protein PDZK1 downregulation and Na?/H? exchanger NHE3 dysfunction in human and murine colitis.
24869908 2014 Correlation between PDZK1, Cdc37, Akt and breast cancer malignancy: the role of PDZK1 in cell growth through Akt stabilization by increasing and interacting with Cdc37.
24728453 2014 PDZK1 and NHERF1 regulate the function of human organic anion transporting polypeptide 1A2 (OATP1A2) by modulating its subcellular trafficking and stability.
24436471 2014 Na?/H? exchanger regulatory factor 3 is critical for multidrug resistance protein 4-mediated drug efflux in the kidney.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24152035 2014 Variants in the 1q21 risk region are associated with a visual endophenotype of autism and schizophrenia.
23821363 2013 PDZK1 is a novel factor in breast cancer that is indirectly regulated by estrogen through IGF-1R and promotes estrogen-mediated growth.
23547718 2013 Systematic antibody generation and validation via tissue microarray technology leading to identification of a novel protein prognostic panel in breast cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
22696060 2012 PDZK1 upregulation in estrogen-related hyperpigmentation in melasma.
22528496 2012 PDZ domain-containing 1 (PDZK1) protein regulates phospholipase C-?3 (PLC-?3)-specific activation of somatostatin by forming a ternary complex with PLC-?3 and somatostatin receptors.
21653824 2011 Interaction of the human prostacyclin receptor with the PDZ adapter protein PDZK1: role in endothelial cell migration and angiogenesis.
21183661 2011 PDZK1 binding and serine phosphorylation regulate subcellular trafficking of organic anion transport protein 1a1.
21059598 2011 ATP-binding cassette transporter isoform C2 localizes to the apical plasma membrane via interactions with scaffolding protein.
20949066 2010 The SR-BI partner PDZK1 facilitates hepatitis C virus entry.
20884846 2010 Multiple genetic loci influence serum urate levels and their relationship with gout and cardiovascular disease risk factors.
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20632170 2010 Role of NHERF and scaffolding proteins in proximal tubule transport.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20237154 2010 A regulated complex of the scaffolding proteins PDZK1 and EBP50 with ezrin contribute to microvillar organization.
20162743 2010 Common variants in SLC17A3 gene affect intra-personal variation in serum uric acid levels in longitudinal time series.
20162742 2010 Predictive value of 8 genetic loci for serum uric acid concentration.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19890391 2009 Common polymorphisms influencing serum uric acid levels contribute to susceptibility to gout, but not to coronary artery disease.
19861489 2010 Replication of the five novel loci for uric acid concentrations and potential mediating mechanisms.
19535329 2009 NHERF3 (PDZK1) contributes to basal and calcium inhibition of NHE3 activity in Caco-2BBe cells.
19503597 2009 Meta-analysis of 28,141 individuals identifies common variants within five new loci that influence uric acid concentrations.
19447883 2009 Intestinal anion exchanger down-regulated in adenoma (DRA) is inhibited by intracellular calcium.
19421056 2009 Role of the adaptor protein PDZK1 in controlling the HDL receptor SR-BI.
19321583 2009 Genetic variants at the PDZ-interacting domain of the scavenger receptor class B type I interact with diet to influence the risk of metabolic syndrome in obese men and women.
19173579 2009 The scaffold protein PDZK1 undergoes a head-to-tail intramolecular association that negatively regulates its interaction with EBP50.
19091402 2009 Regulation of protein expression and function of octn2 in forskolin-induced syncytialization in BeWo Cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18955051 2008 Regulation of the human PDZK1 expression by peroxisome proliferator-activated receptor alpha.
18403724 2008 Coexpression of CLA-1 and human PDZK1 in murine liver modulates HDL cholesterol metabolism.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17990980 2008 The C-terminus of the transmembrane mucin MUC17 binds to the scaffold protein PDZK1 that stably localizes it to the enterocyte apical membrane in the small intestine.
17602283 2008 Comparison of the interaction of human organic anion transporter hOAT4 with PDZ proteins between kidney cells and placental cells.
17507652 2007 Binding of CAP70 to inducible nitric oxide synthase and implications for the vectorial release of nitric oxide in polarized cells.
16738539 2006 The PDZ domain protein PDZK1 interacts with human peptide transporter PEPT2 and enhances its transport activity.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
16236806 2005 Modulation of renal apical organic anion transporter 4 function by two PDZ domain-containing proteins.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16141316 2005 Role of PDZK1 in membrane expression of renal brush border ion exchangers.
16012170 2005 Interactions with PDZ domain proteins PIST/GOPC and PDZK1 regulate intracellular sorting of the somatostatin receptor subtype 5.
15994332 2005 Interaction with PDZK1 is required for expression of organic anion transporting protein 1A1 on the hepatocyte surface.
15767854 2005 Regulation of SR-BI-mediated high-density lipoprotein metabolism by the tissue-specific adaptor protein PDZK1.
15766278 2005 The CFTR associated protein CAP70 interacts with the apical Cl-/HCO3- exchanger DRA in rabbit small intestinal mucosa.
15523054 2005 PDZK1 directly regulates the function of organic cation/carnitine transporter OCTN2.
15494376 2004 Bcr (breakpoint cluster region) protein binds to PDZ-domains of scaffold protein PDZK1 and vesicle coat protein Mint3.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15304510 2004 The multivalent PDZ domain-containing protein PDZK1 regulates transport activity of renal urate-anion exchanger URAT1 via its C terminus.
15215163 2004 Overexpression of PDZK1 within the 1q12-q22 amplicon is likely to be associated with drug-resistance phenotype in multiple myeloma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14531806 2003 PDZK1: I. a major scaffolder in brush borders of proximal tubular cells.
12837682 2003 Interactions of MAP17 with the NaPi-IIa/PDZK1 protein complex in renal proximal tubular cells.
12754212 2003 Identification of small PDZK1-associated protein, DD96/MAP17, as a regulator of PDZK1 and plasma high density lipoprotein levels.
12615054 2003 C-terminal phosphorylation of MRP2 modulates its interaction with PDZ proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471024 2003 The PDZ-binding chloride channel ClC-3B localizes to the Golgi and associates with cystic fibrosis transmembrane conductance regulator-interacting PDZ proteins.
12424224 2003 NEPH1 defines a novel family of podocin interacting proteins.
12119305 2002 A carboxyl-terminal PDZ-interacting domain of scavenger receptor B, type I is essential for cell surface expression in liver.
11099500 2001 Interaction of the type IIa Na/Pi cotransporter with PDZ proteins.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11051556 2000 Accessory protein facilitated CFTR-CFTR interaction, a molecular mechanism to potentiate the chloride channel activity.
10496535 1999 PDZK1, a novel PDZ domain-containing protein up-regulated in carcinomas and mapped to chromosome 1q21, interacts with cMOAT (MRP2), the multidrug resistance-associated protein.
9924606 1998 A PDZ domain-containing protein with homology to Diphor-1 maps to human chromosome 1q21.
9461128 1998 Identification and partial characterization of PDZK1: a novel protein containing PDZ interaction domains.