Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.25
PubTator Score 4.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Usher syndrome, type 2A 2 0.0 0.0
Usher syndrome, type 2C 2 0.0 0.0
Disease Target Count
Usher Syndrome, Type II 5
Disease Target Count P-value
psoriasis 6694 2.8e-80
sonic hedgehog group medulloblastoma 467 1.8e-05
osteosarcoma 7950 7.1e-05
breast carcinoma 1638 2.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Pervasive developmental disorder 9 0.0 0.8
Disease Target Count Z-score Confidence
Retinitis Pigmentosa 226 3.162 1.6
Disease Target Count Z-score Confidence
Usher syndrome 32 5.745 2.9
Nonsyndromic deafness 142 4.103 2.1
Blindness 88 3.146 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma 1.200 2.4e-02
osteosarcoma 1.093 7.1e-05
psoriasis -2.200 2.8e-80
sonic hedgehog group medulloblastoma -1.100 1.8e-05

Gene RIF (7)

AA Sequence

MAQGFAVGFDPLGLGDLSSGSLSSLSSRGHLGSDSGSTATRYLLRKQQRLLNGPPRGIRASSPMGRVILI      1 - 70
NSPIEANSDESDIIHSVRVEKSPAGRLGFSVRGGSEHGLGIFVSKVEEGSSAERAGLCVGDKITEVNGLS     71 - 140
LESTTMGSAVKVLTSSSRLHMMVRRMGRVPGIKFSKEKTTWVDVVNRRLVVEKCGSTPSDTSSEDGVRRI    141 - 210
VHLYTTSDDFCLGFNIRGGKEFGLGIYVSKVDHGGLAEENGIKVGDQVLAANGVRFDDISHSQAVEVLKG    211 - 280
QTHIMLTIKETGRYPAYKEMVSEYCWLDRLSNGVLQQLSPASESSSSVSSCASSAPYSSGSLPSDRMDIC    281 - 350
LGQEEPGSRGPGWGRADTAMQTEPDAGGRVETWCSVRPTVILRDTAIRSDGPHPGRRLDSALSESPKTAL    351 - 420
LLALSRPRPPITRSQSYLTLWEEKQQRKKEKSGSPGEKGALQRSKTLMNLFFKGGRQGRLARDGRREAWT    421 - 490
LDSGSLAKTYPRLDIEKEMGVSPCCPG                                               491 - 517
//

Text Mined References (16)

PMID Year Title