Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.17
PubTator Score 8.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ulcerative colitis 1819 3.5e-06
osteosarcoma 7950 4.7e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Diarrhea 253 3.345 1.7
Irritable bowel syndrome 60 3.159 1.6
Dysentery 10 3.058 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.092 4.7e-05
ulcerative colitis -1.100 3.5e-06

Gene RIF (4)

AA Sequence

MVTPSPPGNHSLSLEAPRLHTASDLLGNHSLGLPLITALVGSRDRRGRVFSPVPVPLPTNPTTQHPTRQK      1 - 70
LPSTLSGHRVCQAHGEPVLGLCPLLPLFCCPPHPPDPWSLERPRFCLLSKEEGKSFGFHLQQELGRAGHV     71 - 140
VCRVDPGTSAQRQGLQEGDRILAVNNDVVEHEDYAVVVRRIRASSPRVLLTVLARHAHDVARAQLGEDAH    141 - 210
LCPTLGPGVRPRLCHIVKDEGGFGFSVTHGNQGPFWLVLSTGGAAERAGVPPGARLLEVNGVSVEKFTHN    211 - 280
QLTRKLWQSGQQVTLLVAGPEVEEQCRQLGLPLAAPLAEGWALPTKPRCLHLEKGPQGFGFLLREEKGLD    281 - 350
GRPGQFLWEVDPGLPAKKAGMQAGDRLVAVAGESVEGLGHEETVSRIQGQGSCVSLTVVDPEADRFFSMV    351 - 420
RLSPLLFLENTEAPASPRGSSSASLVETEDPSLEDTSVPSVPLGSRQCFLYPGPGGSYGFRLSCVASGPR    421 - 490
LFISQVTPGGSAARAGLQVGDVILEVNGYPVGGQNDLERLQQLPEAEPPLCLKLAARSLRGLEAWIPPGA    491 - 560
AEDWALASDLL                                                               561 - 571
//

Text Mined References (13)

PMID Year Title