Property Summary

NCBI Gene PubMed Count 21
PubMed Score 69.08
PubTator Score 26.69

Knowledge Summary


No data available


  Disease (5)


  Differential Expression (31)

Disease log2 FC p
malignant mesothelioma 1.800 1.7e-05
oligodendroglioma 1.200 1.3e-02
Barrett's esophagus -1.100 4.3e-02
esophageal adenocarcinoma -1.700 2.1e-02
psoriasis -1.400 2.8e-08
ependymoma -1.300 6.9e-04
medulloblastoma -2.100 3.3e-04
atypical teratoid / rhabdoid tumor -3.000 1.3e-07
glioblastoma -1.700 3.5e-02
medulloblastoma, large-cell -4.000 2.9e-06
primitive neuroectodermal tumor -2.100 6.1e-03
Atopic dermatitis -1.100 2.6e-04
non-small cell lung cancer -2.325 7.2e-14
intraductal papillary-mucinous adenoma (... 2.200 5.3e-03
lung cancer -3.200 7.7e-05
breast carcinoma -1.400 2.7e-03
fibroadenoma -1.800 1.4e-02
lung adenocarcinoma -2.000 9.3e-18
pilocytic astrocytoma 1.800 2.4e-04
subependymal giant cell astrocytoma -3.130 2.3e-02
nasopharyngeal carcinoma -1.300 6.8e-03
Endometriosis -1.366 4.0e-02
lung carcinoma -1.800 7.5e-19
spina bifida -2.749 4.1e-02
Pick disease 1.300 1.3e-04
progressive supranuclear palsy 1.400 4.8e-03
Breast cancer -1.100 1.3e-02
ductal carcinoma in situ -2.200 6.3e-04
invasive ductal carcinoma -3.200 5.5e-03
ovarian cancer -3.300 4.3e-14
pituitary cancer -1.700 1.1e-03

Gene RIF (10)

24827138 The DNA copy number variations disrupt PDZD2 and GOLPH3 genes predominantly expressed in placenta, and it may represent a novel risk factor for recurrent miscarriage.
21451436 This study does not support the association of PDZD2, GOLPH3, and MTMR12 genes with schizophrenia.
21061259 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19046020 PDZ-domain containing-2 (PDZD2) drives the maturity of human fetal pancreatic progenitor-derived islet-like cell clusters with functional responsiveness against membrane depolarization.
18639375 sPDZD2 sensitized mutant p53-positive DU145 cells and wild-type p53-positive MCF-7 cells to apoptosis induction through genotoxic stress imposed by sub-lethal concentration of hydrogen peroxide
18037333 Results show that a novel pancreatic developmental factor, PDZD2, is sufficient to promote the proliferation of human fetal PPCs while limiting differentiation of ICCs into islet/endocrine cells.
16413998 The mitogenic effect of secreted PDZD2 was concentration-dependent, and was associated with a slight inhibition of the insulin promoter activity at high sPDZD2 concentrations.
12671685 the first reported multi-PDZ protein that is processed by proteolytic cleavage to generate a secreted peptide containing two PDZ domains

AA Sequence

LAINGKPLVGLMHFDAWNIMKSVPEGPVQLLIRKHRNSS                                  2801 - 2839

Text Mined References (21)

PMID Year Title
24827138 2014 Structural genomic variation as risk factor for idiopathic recurrent miscarriage.
24528284 2014 Citalopram and escitalopram plasma drug and metabolite concentrations: genome-wide associations.
24322204 2014 Genome-wide association study of bipolar disorder accounting for effect of body mass index identifies a new risk allele in TCF7L2.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23184150 2013 Common variation at 2q22.3 (ZEB2) influences the risk of renal cancer.
21451436 2012 Mutation screening of PDZD2, GOLPH3, and MTMR12 genes in patients with schizophrenia.
21061259 2011 Genome-wide association study of genetic predictors of anti-tumor necrosis factor treatment efficacy in rheumatoid arthritis identifies associations with polymorphisms at seven loci.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19046020 2009 PDZ-domain containing-2 (PDZD2) drives the maturity of human fetal pancreatic progenitor-derived islet-like cell clusters with functional responsiveness against membrane depolarization.
18639375 2008 The autocrine human secreted PDZ domain-containing protein 2 (sPDZD2) induces senescence or quiescence of prostate, breast and liver cancer cells via transcriptional activation of p53.
18037333 2008 PDZ-domain containing-2 (PDZD2) is a novel factor that affects the growth and differentiation of human fetal pancreatic progenitor cells.
16413998 2006 Secreted PDZD2 exerts concentration-dependent effects on the proliferation of INS-1E cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12671685 2003 Proteolytic cleavage of PDZD2 generates a secreted peptide containing two PDZ domains.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12370826 2002 Localization of p0071-interacting proteins, plakophilin-related armadillo-repeat protein-interacting protein (PAPIN) and ERBIN, in epithelial cells.
11289102 2001 Activated in prostate cancer: a PDZ domain-containing protein highly expressed in human primary prostate tumors.
10896674 2000 PAPIN. A novel multiple PSD-95/Dlg-A/ZO-1 protein interacting with neural plakophilin-related armadillo repeat protein/delta-catenin and p0071.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.