Property Summary

NCBI Gene PubMed Count 15
PubMed Score 109.87
PubTator Score 4.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma 1.400 1.8e-14
ovarian cancer 1.200 1.7e-04

Protein-protein Interaction (2)

Gene RIF (2)

AA Sequence

MDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQL      1 - 70
GIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH     71 - 140
//

Text Mined References (19)

PMID Year Title